UniProt ID | CC85B_HUMAN | |
---|---|---|
UniProt AC | Q15834 | |
Protein Name | Coiled-coil domain-containing protein 85B | |
Gene Name | CCDC85B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 202 | |
Subcellular Localization | Nucleus . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . | |
Protein Description | Functions as a transcriptional repressor. [PubMed: 17014843 May inhibit the activity of CTNNB1 in a TP53-dependent manner and thus regulate cell growth] | |
Protein Sequence | MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEAEAGGL -------CCCCCCCH | 11.26 | 22814378 | |
119 | Ubiquitination | DLGGCWQKLAELEGR HHCHHHHHHHHHCCH | 25.76 | 30230243 | |
138 | Ubiquitination | LRENLALKELCLALG HHHHHHHHHHHHHHC | 42.93 | 30230243 | |
184 | Phosphorylation | DLGDGSSSTGSVGSP CCCCCCCCCCCCCCC | 38.18 | 25627689 | |
185 | Phosphorylation | LGDGSSSTGSVGSPD CCCCCCCCCCCCCCH | 35.11 | 25627689 | |
187 | Phosphorylation | DGSSSTGSVGSPDQL CCCCCCCCCCCCHHC | 24.32 | 28985074 | |
190 | Phosphorylation | SSTGSVGSPDQLPLA CCCCCCCCCHHCCCC | 24.13 | 28985074 | |
199 | Phosphorylation | DQLPLACSPDD---- HHCCCCCCCCC---- | 26.25 | 28985074 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC85B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC85B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC85B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...