UniProt ID | BEX2_HUMAN | |
---|---|---|
UniProt AC | Q9BXY8 | |
Protein Name | Protein BEX2 | |
Gene Name | BEX2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 128 | |
Subcellular Localization | Cytoplasm. Nucleus . | |
Protein Description | Regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. Protects the breast cancer cells against mitochondrial apoptosis and this effect is mediated through the modulation of BCL2 protein family, which involves the positive regulation of anti-apoptotic member BCL2 and the negative regulation of pro-apoptotic members BAD, BAK1 and PUMA. Required for the normal cell cycle progression during G1 in breast cancer cells through the regulation of CCND1 and CDKN1A. Regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity.. | |
Protein Sequence | MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Methylation | VSEYCVPRGNRRRFR HHHCCCCCCCCCCEE | 34.32 | - | |
98 | Ubiquitination | EVRQLMEKLREKQLS HHHHHHHHHHHHHHH | 38.59 | 27667366 | |
102 | Ubiquitination | LMEKLREKQLSHSLR HHHHHHHHHHHHHHH | 50.54 | 27667366 | |
107 | Phosphorylation | REKQLSHSLRAVSTD HHHHHHHHHHHHCCC | 19.04 | - | |
129 | Ubiquitination | DEFCLMP-------- CCCCCCC-------- | 21890473 | ||
130 | Ubiquitination | EFCLMP--------- CCCCCC--------- | 21890473 | ||
133 | Ubiquitination | LMP------------ CCC------------ | 22053931 | ||
134 | Ubiquitination | MP------------- CC------------- | 22053931 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BEX2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BEX2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BEX2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ADIP_HUMAN | SSX2IP | physical | 25416956 | |
FSD2_HUMAN | FSD2 | physical | 25416956 | |
K1C40_HUMAN | KRT40 | physical | 25416956 | |
MIPO1_HUMAN | MIPOL1 | physical | 25416956 | |
TRI42_HUMAN | TRIM42 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...