BEX2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BEX2_HUMAN
• UniProt AC: Q9BXY8
• Protein Name: Protein BEX2
• Gene Name: BEX2
• Organism: Homo sapiens (Human).
• Sequence Length: 128
• Subcellular Localization: Cytoplasm. Nucleus .
• Protein Description: Regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. Protects the breast cancer cells against mitochondrial apoptosis and this effect is mediated through the modulation of BCL2 protein family, which involves the positive regulation of anti-apoptotic member BCL2 and the negative regulation of pro-apoptotic members BAD, BAK1 and PUMA. Required for the normal cell cycle progression during G1 in breast cancer cells through the regulation of CCND1 and CDKN1A. Regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity..
• Protein Sequence: MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
50	Methylation	VSEYCVPRGNRRRFR HHHCCCCCCCCCCEE	34.32	-
98	Ubiquitination	EVRQLMEKLREKQLS HHHHHHHHHHHHHHH	38.59	27667366
102	Ubiquitination	LMEKLREKQLSHSLR HHHHHHHHHHHHHHH	50.54	27667366
107	Phosphorylation	REKQLSHSLRAVSTD HHHHHHHHHHHHCCC	19.04	-
129	Ubiquitination	DEFCLMP-------- CCCCCCC--------		21890473
130	Ubiquitination	EFCLMP--------- CCCCCC---------		21890473
133	Ubiquitination	LMP------------ CCC------------		22053931
134	Ubiquitination	MP------------- CC-------------		22053931

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BEX2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BEX2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BEX2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ADIP_HUMAN	SSX2IP	physical	25416956
FSD2_HUMAN	FSD2	physical	25416956
K1C40_HUMAN	KRT40	physical	25416956
MIPO1_HUMAN	MIPOL1	physical	25416956
TRI42_HUMAN	TRIM42	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.