dbPTM

F107A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	F107A_HUMAN
UniProt AC	O95990
Protein Name	Protein FAM107A
Gene Name	FAM107A
Organism	Homo sapiens (Human).
Sequence Length	144
Subcellular Localization	Nucleus .
Protein Description	When transfected into cell lines in which it is not expressed, suppresses cell growth. May play a role in tumor development..
Protein Sequence	MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
30	Ubiquitination	EWNPELIKPKKLLNP CCCHHHCCHHHHCCH	64.51	-
58	Ubiquitination	LLMNHRRGLGVDSKP HHHHHCCCCCCCCCH	27.09	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of F107A_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of F107A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of F107A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FBLN4_HUMAN	EFEMP2	physical	16189514
LDOC1_HUMAN	LDOC1	physical	16189514
USBP1_HUMAN	USHBP1	physical	16189514
HOOK2_HUMAN	HOOK2	physical	16189514
BEGIN_HUMAN	BEGAIN	physical	16189514
KR412_HUMAN	KRTAP4-12	physical	16189514
NINL_HUMAN	NINL	physical	16189514
2ABA_HUMAN	PPP2R2A	physical	17353931
DCD_HUMAN	DCD	physical	17353931
RINT1_HUMAN	RINT1	physical	25416956
CC136_HUMAN	CCDC136	physical	25416956
USBP1_HUMAN	USHBP1	physical	25416956
LZTS2_HUMAN	LZTS2	physical	25416956
FSD2_HUMAN	FSD2	physical	25416956
K1C40_HUMAN	KRT40	physical	25416956
ACTB_HUMAN	ACTB	physical	28604741
HFM1_HUMAN	HFM1	physical	28604741
SK2L2_HUMAN	SKIV2L2	physical	28604741
IQUB_HUMAN	IQUB	physical	28604741
FKBP6_HUMAN	FKBP6	physical	28604741
RAB18_HUMAN	RAB18	physical	28604741
COMD1_HUMAN	COMMD1	physical	28604741
PSMD6_HUMAN	PSMD6	physical	28604741
CPSF3_HUMAN	CPSF3	physical	28604741
RNLS_HUMAN	RNLS	physical	28604741
AZI2_HUMAN	AZI2	physical	28604741
SPEB_HUMAN	AGMAT	physical	28604741
HSP7E_HUMAN	HSPA14	physical	28604741
MEIOB_HUMAN	MEIOB	physical	28604741
SPT22_HUMAN	SPATA22	physical	28604741
BIRC8_HUMAN	BIRC8	physical	28604741
RRF2M_HUMAN	GFM2	physical	28604741
CH60_HUMAN	HSPD1	physical	28604741
NEXN_HUMAN	NEXN	physical	28604741
AUHM_HUMAN	AUH	physical	28604741
SSFA2_HUMAN	SSFA2	physical	28604741
POMP_HUMAN	POMP	physical	28604741
PLS1_HUMAN	PLSCR1	physical	28604741
IF4A1_HUMAN	EIF4A1	physical	28604741
APBP2_HUMAN	APPBP2	physical	28604741
EFHC2_HUMAN	EFHC2	physical	28604741
HTRA1_HUMAN	HTRA1	physical	28604741

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of F107A_HUMAN

Related Literatures of Post-Translational Modification