UniProt ID | KR412_HUMAN | |
---|---|---|
UniProt AC | Q9BQ66 | |
Protein Name | Keratin-associated protein 4-12 | |
Gene Name | KRTAP4-12 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 201 | |
Subcellular Localization | ||
Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
Protein Sequence | MVNSCCGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCISSSCCPSCCESSCCRPCCCLRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSCC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
33 | Phosphorylation | CQTTCCRTTCCRPSC HCCCCCCCCCCCCCE | 15.40 | - | |
34 | Phosphorylation | QTTCCRTTCCRPSCC CCCCCCCCCCCCCEE | 7.11 | - | |
73 | Phosphorylation | CQTTCCRTTCCRPSC CCCEECCCCCCCCCE | 15.40 | - | |
74 | Phosphorylation | QTTCCRTTCCRPSCC CCEECCCCCCCCCEE | 7.11 | - | |
113 | Phosphorylation | CQTTCCRTTCCRPSC CCCEECCCCCCCCCE | 15.40 | - | |
114 | Phosphorylation | QTTCCRTTCCRPSCC CCEECCCCCCCCCEE | 7.11 | - | |
184 | Phosphorylation | HTTCYRPTCVISTCP CCCCCCCCEEEECCC | 15.48 | 20068231 | |
188 | Phosphorylation | YRPTCVISTCPRPLC CCCCEEEECCCCCEE | 11.98 | 20068231 | |
189 | Phosphorylation | RPTCVISTCPRPLCC CCCEEEECCCCCEEE | 18.53 | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KR412_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KR412_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KR412_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...