| UniProt ID | KRA32_HUMAN | |
|---|---|---|
| UniProt AC | Q9BYR7 | |
| Protein Name | Keratin-associated protein 3-2 | |
| Gene Name | KRTAP3-2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 98 | |
| Subcellular Localization | ||
| Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
| Protein Sequence | MDCCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPRGC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRA32_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRA32_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRA32_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KRA32_HUMAN | KRTAP3-2 | physical | 25416956 | |
| KRA92_HUMAN | KRTAP9-2 | physical | 25416956 | |
| DHRS1_HUMAN | DHRS1 | physical | 25416956 | |
| TBC16_HUMAN | TBC1D16 | physical | 25416956 | |
| LCE4A_HUMAN | LCE4A | physical | 25416956 | |
| CE060_HUMAN | C5orf60 | physical | 25416956 | |
| TRI42_HUMAN | TRIM42 | physical | 25416956 | |
| LCE1B_HUMAN | LCE1B | physical | 25416956 | |
| LCE2A_HUMAN | LCE2A | physical | 25416956 | |
| LCE3C_HUMAN | LCE3C | physical | 25416956 | |
| LCE3E_HUMAN | LCE3E | physical | 25416956 | |
| KR122_HUMAN | KRTAP12-2 | physical | 25416956 | |
| KR101_HUMAN | KRTAP10-1 | physical | 25416956 | |
| KR261_HUMAN | KRTAP26-1 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...