LCE1B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LCE1B_HUMAN
• UniProt AC: Q5T7P3
• Protein Name: Late cornified envelope protein 1B
• Gene Name: LCE1B
• Organism: Homo sapiens (Human).
• Sequence Length: 118
• Protein Description: Precursors of the cornified envelope of the stratum corneum..
• Protein Sequence: MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
93	Phosphorylation	HCHRPQSSGCCSQPS CCCCCCCCCCCCCCC	30.51	30576142
110	Phosphorylation	SSCCGGGSGQHSGGC CCCCCCCCCCCCCCC	38.26	30576142

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LCE1B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LCE1B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LCE1B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR107_HUMAN	KRTAP10-7	physical	25416956
KR109_HUMAN	KRTAP10-9	physical	25416956
KR101_HUMAN	KRTAP10-1	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.