KRA92_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KRA92_HUMAN
• UniProt AC: Q9BYQ4
• Protein Name: Keratin-associated protein 9-2
• Gene Name: KRTAP9-2
• Organism: Homo sapiens (Human).
• Sequence Length: 174
• Protein Description: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins..
• Protein Sequence: MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPACCVSSCCQPCCRPTCCQNTCCRTTCCQPTCVTSCCQPSCCSTPCCQPTCCGSSCCGQTSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSNCCQPCCRPACCETTCCRTTCFQPTCVSSCCQPSCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTHCCSPCC ------CCCCCCCCC	24.50	24043423
6	Phosphorylation	--MTHCCSPCCQPTC --CCCCCCCCCCCCE	26.77	24043423
12	Phosphorylation	CSPCCQPTCCRTTCC CCCCCCCCEECCEEE	9.81	24043423
16	Phosphorylation	CQPTCCRTTCCRTTC CCCCEECCEEECCCC	15.40	24043423
17	Phosphorylation	QPTCCRTTCCRTTCW CCCEECCEEECCCCC	7.11	24043423
167	Phosphorylation	FQPTCVSSCCQPSCC CCCCCHHHCCCCCCC	9.87	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KRA92_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KRA92_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KRA92_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KRA92_HUMAN	KRTAP9-2	physical	25416956
LNX1_HUMAN	LNX1	physical	25416956
KRA94_HUMAN	KRTAP9-4	physical	25416956
KRA42_HUMAN	KRTAP4-2	physical	25416956
PTPM1_HUMAN	PTPMT1	physical	25416956
CTSR1_HUMAN	CATSPER1	physical	25416956
FA76B_HUMAN	FAM76B	physical	25416956
SPAT8_HUMAN	SPATA8	physical	25416956
LCE4A_HUMAN	LCE4A	physical	25416956
LCE1B_HUMAN	LCE1B	physical	25416956
LCE2A_HUMAN	LCE2A	physical	25416956
LCE3E_HUMAN	LCE3E	physical	25416956
KR107_HUMAN	KRTAP10-7	physical	25416956
KR109_HUMAN	KRTAP10-9	physical	25416956
KR101_HUMAN	KRTAP10-1	physical	25416956
KR10B_HUMAN	KRTAP10-11	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956
KR261_HUMAN	KRTAP26-1	physical	25416956
KRA56_HUMAN	KRTAP5-6	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.