LCE4A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LCE4A_HUMAN
• UniProt AC: Q5TA78
• Protein Name: Late cornified envelope protein 4A
• Gene Name: LCE4A
• Organism: Homo sapiens (Human).
• Sequence Length: 99
• Protein Description: Precursors of the cornified envelope of the stratum corneum..
• Protein Sequence: MSCQQNQQQCQPPPKCPIPKYPPKCPSKCASSCPPPISSCCGSSSGGCGCCSSEGGGCCLSHHRHHRSHCHRPKSSNCYGSGSGQQSGGSGCCSGGGCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSCQQNQQQ ------CCCHHHHHH	22.19	28634298
83	Phosphorylation	SNCYGSGSGQQSGGS CCCCCCCCCCCCCCC	34.82	22817900
87	Phosphorylation	GSGSGQQSGGSGCCS CCCCCCCCCCCCCCC	36.91	22817900
90	Phosphorylation	SGQQSGGSGCCSGGG CCCCCCCCCCCCCCC	31.98	-
94	Phosphorylation	SGGSGCCSGGGCC-- CCCCCCCCCCCCC--	44.54	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LCE4A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LCE4A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LCE4A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR122_HUMAN	KRTAP12-2	physical	25416956
KR107_HUMAN	KRTAP10-7	physical	25416956
KR109_HUMAN	KRTAP10-9	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.