UniProt ID | KRA94_HUMAN | |
---|---|---|
UniProt AC | Q9BYQ2 | |
Protein Name | Keratin-associated protein 9-4 | |
Gene Name | KRTAP9-4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 154 | |
Subcellular Localization | ||
Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
Protein Sequence | MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPTCCQNTCCQPTCVTSCCQPSCCSTPCCQPTCCGSSCDQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSNCCQPCCRPACCETTCFQPTCVSSCCQPFCC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTHCCSPCC ------CCCCCCCCC | 24.50 | 24043423 | |
6 | Phosphorylation | --MTHCCSPCCQPTC --CCCCCCCCCCCCE | 26.77 | 24043423 | |
12 | Phosphorylation | CSPCCQPTCCRTTCC CCCCCCCCEECCEEE | 9.81 | 24043423 | |
16 | Phosphorylation | CQPTCCRTTCCRTTC CCCCEECCEEECCCC | 15.40 | 24043423 | |
17 | Phosphorylation | QPTCCRTTCCRTTCW CCCEECCEEECCCCC | 7.11 | 24043423 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRA94_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRA94_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRA94_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KRA42_HUMAN | KRTAP4-2 | physical | 25416956 | |
DHX57_HUMAN | DHX57 | physical | 25416956 | |
CTSR1_HUMAN | CATSPER1 | physical | 25416956 | |
LCE4A_HUMAN | LCE4A | physical | 25416956 | |
LCE1B_HUMAN | LCE1B | physical | 25416956 | |
LCE3C_HUMAN | LCE3C | physical | 25416956 | |
LCE3E_HUMAN | LCE3E | physical | 25416956 | |
KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
KR101_HUMAN | KRTAP10-1 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
KRA56_HUMAN | KRTAP5-6 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...