| UniProt ID | LCE3E_HUMAN | |
|---|---|---|
| UniProt AC | Q5T5B0 | |
| Protein Name | Late cornified envelope protein 3E | |
| Gene Name | LCE3E | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 92 | |
| Subcellular Localization | ||
| Protein Description | Precursors of the cornified envelope of the stratum corneum.. | |
| Protein Sequence | MSCQQNQKQCQPPPKCPSPKCPPKNPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRSNSCDRGSGQQGGGSGCCHGSGGCC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 70 | Phosphorylation | CRRQRSNSCDRGSGQ HHHHHCCCCCCCCCC | 20.74 | 32645325 | |
| 82 | Phosphorylation | SGQQGGGSGCCHGSG CCCCCCCCCCCCCCC | 31.75 | - | |
| 88 | Phosphorylation | GSGCCHGSGGCC--- CCCCCCCCCCCC--- | 14.35 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LCE3E_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LCE3E_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LCE3E_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
| KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
| KR101_HUMAN | KRTAP10-1 | physical | 25416956 | |
| KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...