UniProt ID | KRA42_HUMAN | |
---|---|---|
UniProt AC | Q9BYR5 | |
Protein Name | Keratin-associated protein 4-2 | |
Gene Name | KRTAP4-2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 136 | |
Subcellular Localization | ||
Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
Protein Sequence | MVNSCCGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCSPSCCQTTCCRTTCCRPSCCVSSCFRPQCCQSVYCQPTCCRPSCGQTTCCRTTCYRPSCCVSTCCRPTCSSGSCC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
33 | Phosphorylation | CQTTCCRTTCCRPSC HCCCCCCCCCCCCCE | 15.40 | - | |
34 | Phosphorylation | QTTCCRTTCCRPSCC CCCCCCCCCCCCCEE | 7.11 | - | |
73 | Phosphorylation | CQTTCCRTTCCRPSC HCCCCCCCCCCCCCE | 15.40 | - | |
74 | Phosphorylation | QTTCCRTTCCRPSCC CCCCCCCCCCCCCEE | 7.11 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRA42_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRA42_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRA42_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SPTA3_HUMAN | SPATA3 | physical | 25416956 | |
ZN417_HUMAN | ZNF417 | physical | 25416956 | |
TEANC_HUMAN | TCEANC | physical | 25416956 | |
LCE4A_HUMAN | LCE4A | physical | 25416956 | |
SPA24_HUMAN | SPATA24 | physical | 25416956 | |
TRI42_HUMAN | TRIM42 | physical | 25416956 | |
LCE1B_HUMAN | LCE1B | physical | 25416956 | |
LCE2A_HUMAN | LCE2A | physical | 25416956 | |
LCE3C_HUMAN | LCE3C | physical | 25416956 | |
LCE3E_HUMAN | LCE3E | physical | 25416956 | |
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
KR101_HUMAN | KRTAP10-1 | physical | 25416956 | |
KR10B_HUMAN | KRTAP10-11 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
KR261_HUMAN | KRTAP26-1 | physical | 25416956 | |
KRA56_HUMAN | KRTAP5-6 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...