| UniProt ID | LCE3C_HUMAN | |
|---|---|---|
| UniProt AC | Q5T5A8 | |
| Protein Name | Late cornified envelope protein 3C {ECO:0000303|PubMed:15854049} | |
| Gene Name | LCE3C {ECO:0000303|PubMed:15854049, ECO:0000312|HGNC:HGNC:16612} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 94 | |
| Subcellular Localization | ||
| Protein Description | A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens. [PubMed: 28634035] | |
| Protein Sequence | MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 25 | Phosphorylation | SPKCPPKSPAQCLPP CCCCCCCCHHHCCCC | 31.10 | 22210691 | |
| 62 | Phosphorylation | SHHRHFRSHQCRRQR HHCHHHHHHHHHHHH | 19.57 | 22210691 | |
| 70 | Phosphorylation | HQCRRQRSNSCDRGS HHHHHHHCCCCCCCC | 25.42 | 30576142 | |
| 72 | Phosphorylation | CRRQRSNSCDRGSGQ HHHHHCCCCCCCCCC | 20.74 | 30576142 | |
| 84 | Phosphorylation | SGQQGGGSCRGHGSG CCCCCCCCCCCCCCC | 12.15 | 30576142 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LCE3C_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LCE3C_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LCE3C_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
| KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...