dbPTM

LCE3C_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LCE3C_HUMAN
UniProt AC	Q5T5A8
Protein Name	Late cornified envelope protein 3C {ECO:0000303\|PubMed:15854049}
Gene Name	LCE3C {ECO:0000303\|PubMed:15854049, ECO:0000312\|HGNC:HGNC:16612}
Organism	Homo sapiens (Human).
Sequence Length	94
Subcellular Localization
Protein Description	A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens. [PubMed: 28634035]
Protein Sequence	MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	SPKCPPKSPAQCLPP CCCCCCCCHHHCCCC	31.10	22210691
62	Phosphorylation	SHHRHFRSHQCRRQR HHCHHHHHHHHHHHH	19.57	22210691
70	Phosphorylation	HQCRRQRSNSCDRGS HHHHHHHCCCCCCCC	25.42	30576142
72	Phosphorylation	CRRQRSNSCDRGSGQ HHHHHCCCCCCCCCC	20.74	30576142
84	Phosphorylation	SGQQGGGSCRGHGSG CCCCCCCCCCCCCCC	12.15	30576142

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LCE3C_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LCE3C_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LCE3C_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR109_HUMAN	KRTAP10-9	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LCE3C_HUMAN

Related Literatures of Post-Translational Modification