UniProt ID | SPTA3_HUMAN | |
---|---|---|
UniProt AC | Q8NHX4 | |
Protein Name | Spermatogenesis-associated protein 3 | |
Gene Name | SPATA3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 192 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKKVKKKRSEARRHRDSTSQHASSNSTSQQPSPESTPQQPSPESTPQQPSPESTPQHSSLETTSRQPAFQALPAPEIRRSSCCLLSPDANVKAAPQSRKAGPLIRAGPHSCSCATCPCSSACWRRLGLCHSRIFDVLLPRDWQMAPGRGLPNLLTFYRKSSRKPSSHRNACPPSPRNCGCGSGGSRSCLLHH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
80 | Phosphorylation | PAPEIRRSSCCLLSP CCHHHHCCCCEEECC | 26.54 | 30622161 | |
81 | Phosphorylation | APEIRRSSCCLLSPD CHHHHCCCCEEECCC | 43.11 | 30622161 | |
86 | Phosphorylation | RSSCCLLSPDANVKA CCCCEEECCCCCCCC | 37.22 | 30622161 | |
110 | Phosphorylation | LIRAGPHSCSCATCP CEECCCCCCCCCCCC | 13.20 | - | |
112 | Phosphorylation | RAGPHSCSCATCPCS ECCCCCCCCCCCCCC | 4.80 | - | |
115 | Phosphorylation | PHSCSCATCPCSSAC CCCCCCCCCCCCHHH | 24.67 | - | |
155 | Phosphorylation | RGLPNLLTFYRKSSR CCCCHHHHHHHHHCC | 39.70 | 24719451 | |
165 | Phosphorylation | RKSSRKPSSHRNACP HHHCCCCCCCCCCCC | 22.95 | - | |
166 | Phosphorylation | KSSRKPSSHRNACPP HHCCCCCCCCCCCCC | 36.96 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPTA3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPTA3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPTA3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...