UniProt ID | DHRS1_HUMAN | |
---|---|---|
UniProt AC | Q96LJ7 | |
Protein Name | Dehydrogenase/reductase SDR family member 1 | |
Gene Name | DHRS1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 313 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAPMNGQV ------CCCCCCCCE | 21.92 | 22814378 | |
13 | Phosphorylation | NGQVCVVTGASRGIG CCCEEEEECCCCCCC | 13.46 | 24043423 | |
16 | Phosphorylation | VCVVTGASRGIGRGI EEEEECCCCCCCHHH | 32.17 | 24043423 | |
21 | Methylation | GASRGIGRGIALQLC CCCCCCCHHHHHHHH | 31.27 | - | |
29 | Ubiquitination | GIALQLCKAGATVYI HHHHHHHHCCCEEEE | 59.45 | 21906983 | |
73 | Phosphorylation | SQESEVRSLFEQVDR CCHHHHHHHHHHHCH | 42.45 | 20873877 | |
106 | Ubiquitination | TILNTRNKAFWETPA HHHHCCCCCCCCCCH | 41.49 | 21906983 | |
133 | Phosphorylation | GHYFCSVYGARLMVP CEEEHHHCCCEEEEE | 6.70 | 21253578 | |
172 | Ubiquitination | VGKAACDKLAADCAH CCHHHHHHHHHHHHH | 39.65 | 29967540 | |
187 | Phosphorylation | ELRRHGVSCVSLWPG HHHHCCCCHHHCCCC | 17.25 | 20068231 | |
190 | Phosphorylation | RHGVSCVSLWPGIVQ HCCCCHHHCCCCHHH | 29.10 | 20068231 | |
198 | Phosphorylation | LWPGIVQTELLKEHM CCCCHHHHHHHHHHH | 20.08 | 20068231 | |
202 | Ubiquitination | IVQTELLKEHMAKEE HHHHHHHHHHHCHHH | 59.19 | 29967540 | |
207 | Ubiquitination | LLKEHMAKEEVLQDP HHHHHHCHHHHHCCH | 47.00 | 29967540 | |
217 | Ubiquitination | VLQDPVLKQFKSAFS HHCCHHHHHHHHHHC | 54.65 | 23000965 | |
220 | Ubiquitination | DPVLKQFKSAFSSAE CHHHHHHHHHHCCCC | 38.08 | 23000965 | |
221 | Phosphorylation | PVLKQFKSAFSSAET HHHHHHHHHHCCCCC | 35.52 | 23312004 | |
224 | Phosphorylation | KQFKSAFSSAETTEL HHHHHHHCCCCCCCC | 28.49 | 23312004 | |
225 | Phosphorylation | QFKSAFSSAETTELS HHHHHHCCCCCCCCC | 24.54 | 23312004 | |
228 | Phosphorylation | SAFSSAETTELSGKC HHHCCCCCCCCCCCE | 25.86 | 23312004 | |
229 | Phosphorylation | AFSSAETTELSGKCV HHCCCCCCCCCCCEE | 26.83 | 23312004 | |
247 | Phosphorylation | ATDPNILSLSGKVLP ECCCCEECCCCCCCC | 19.38 | - | |
249 | Phosphorylation | DPNILSLSGKVLPSC CCCEECCCCCCCCCC | 32.94 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHRS1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHRS1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHRS1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...