LCE2D_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LCE2D_HUMAN
• UniProt AC: Q5TA82
• Protein Name: Late cornified envelope protein 2D
• Gene Name: LCE2D
• Organism: Homo sapiens (Human).
• Sequence Length: 110
• Protein Description: Precursors of the cornified envelope of the stratum corneum..
• Protein Sequence: MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCCSSGGGGCCLSHHRPRLFHRRRHQSPDCCESEPSGASGCCHSSGGCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
88	Phosphorylation	FHRRRHQSPDCCESE CCCCCCCCCCCCCCC	19.31	30576142
94	Phosphorylation	QSPDCCESEPSGASG CCCCCCCCCCCCCCC	40.67	30576142
97	Phosphorylation	DCCESEPSGASGCCH CCCCCCCCCCCCCCC	42.83	30576142
100	Phosphorylation	ESEPSGASGCCHSSG CCCCCCCCCCCCCCC	35.57	30576142
105	Phosphorylation	GASGCCHSSGGCC-- CCCCCCCCCCCCC--	19.43	30576142
106	Phosphorylation	ASGCCHSSGGCC--- CCCCCCCCCCCC---	18.62	30576142

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LCE2D_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LCE2D_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LCE2D_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LCE2D_HUMAN	LCE2D	physical	25416956
KR109_HUMAN	KRTAP10-9	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.