UniProt ID | RNLS_HUMAN | |
---|---|---|
UniProt AC | Q5VYX0 | |
Protein Name | Renalase {ECO:0000303|PubMed:15841207} | |
Gene Name | RNLS | |
Organism | Homo sapiens (Human). | |
Sequence Length | 342 | |
Subcellular Localization | Secreted . | |
Protein Description | Catalyzes the oxidation of the less abundant 1,2-dihydro-beta-NAD(P) and 1,6-dihydro-beta-NAD(P) to form beta-NAD(P)(+). The enzyme hormone is secreted by the kidney, and circulates in blood and modulates cardiac function and systemic blood pressure. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis.. | |
Protein Sequence | MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | LIVGAGMTGSLCAAL EEECCCHHHHHHHHH | 23.77 | 24043423 | |
14 | Phosphorylation | VGAGMTGSLCAALLR ECCCHHHHHHHHHHH | 15.88 | 24043423 | |
44 | Phosphorylation | EDSGGRMTTACSPHN CCCCCCCCCCCCCCC | 15.18 | 24043423 | |
45 | Phosphorylation | DSGGRMTTACSPHNP CCCCCCCCCCCCCCC | 19.14 | 24043423 | |
48 | Phosphorylation | GRMTTACSPHNPQCT CCCCCCCCCCCCCCC | 27.08 | 24043423 | |
55 | Phosphorylation | SPHNPQCTADLGAQY CCCCCCCCCCCCCEE | 20.26 | 24043423 | |
62 | Phosphorylation | TADLGAQYITCTPHY CCCCCCEEEECCHHH | 9.54 | 22817900 | |
64 | Phosphorylation | DLGAQYITCTPHYAK CCCCEEEECCHHHHH | 12.85 | 24043423 | |
66 | Phosphorylation | GAQYITCTPHYAKKH CCEEEECCHHHHHHH | 12.40 | 24043423 | |
69 | Phosphorylation | YITCTPHYAKKHQRF EEECCHHHHHHHHHH | 22.71 | 24043423 | |
113 | Phosphorylation | VAPQGISSIIKHYLK ECCCCHHHHHHHHHH | 26.81 | 24719451 | |
189 | Phosphorylation | RQQLEAVSYSSRYAL HHHHHHCCHHHHHHH | 26.75 | - | |
190 | Phosphorylation | QQLEAVSYSSRYALG HHHHHCCHHHHHHHH | 12.22 | - | |
191 | Phosphorylation | QLEAVSYSSRYALGL HHHHCCHHHHHHHHH | 10.79 | - | |
192 | Phosphorylation | LEAVSYSSRYALGLF HHHCCHHHHHHHHHH | 22.52 | - | |
216 | Phosphorylation | PWAGQYITSNPCIRF CCCHHCCCCCCEEEE | 19.95 | 29449344 | |
217 | Phosphorylation | WAGQYITSNPCIRFV CCHHCCCCCCEEEEE | 29.26 | 29449344 | |
225 | Phosphorylation | NPCIRFVSIDNKKRN CCEEEEEEECCCCCC | 22.85 | 29449344 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNLS_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNLS_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNLS_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RNLS_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...