| UniProt ID | POMP_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y244 | |
| Protein Name | Proteasome maturation protein | |
| Gene Name | POMP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 141 | |
| Subcellular Localization | Cytoplasm, cytosol. Nucleus. Microsome membrane. | |
| Protein Description | Molecular chaperone essential for the assembly of standard proteasomes and immunoproteasomes. Degraded after completion of proteasome maturation. Mediates the association of 20S preproteasome with the endoplasmic reticulum.. | |
| Protein Sequence | MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MNARGLGSELKDSIP CCCCCCCHHHCCCCC | 44.81 | 28122231 | |
| 11 | Ubiquitination | RGLGSELKDSIPVTE CCCCHHHCCCCCCEE | 45.43 | 21906983 | |
| 13 | Phosphorylation | LGSELKDSIPVTELS CCHHHCCCCCCEECC | 27.49 | 21406692 | |
| 17 | Phosphorylation | LKDSIPVTELSASGP HCCCCCCEECCCCCC | 26.34 | 21406692 | |
| 20 | Phosphorylation | SIPVTELSASGPFES CCCCEECCCCCCCCC | 17.73 | 28464451 | |
| 22 | Phosphorylation | PVTELSASGPFESHD CCEECCCCCCCCCHH | 43.55 | 28464451 | |
| 27 | Phosphorylation | SASGPFESHDLLRKG CCCCCCCCHHHHHHC | 23.76 | 21406692 | |
| 33 | Ubiquitination | ESHDLLRKGFSCVKN CCHHHHHHCCCEECC | 65.36 | 23000965 | |
| 36 | Phosphorylation | DLLRKGFSCVKNELL HHHHHCCCEECCCCC | 27.03 | 24719451 | |
| 39 | Sumoylation | RKGFSCVKNELLPSH HHCCCEECCCCCCCC | 49.37 | 28112733 | |
| 39 | Ubiquitination | RKGFSCVKNELLPSH HHCCCEECCCCCCCC | 49.37 | 23000965 | |
| 53 | Ubiquitination | HPLELSEKNFQLNQD CCCCHHHHCCCCCCH | 60.74 | 21906983 | |
| 61 | Ubiquitination | NFQLNQDKMNFSTLR CCCCCCHHCCHHHHH | 26.44 | 23000965 | |
| 66 | Phosphorylation | QDKMNFSTLRNIQGL CHHCCHHHHHHHHHH | 26.12 | - | |
| 78 | Ubiquitination | QGLFAPLKLQMEFKA HHHCCCCCHHHHHHH | 35.30 | 21963094 | |
| 84 | Ubiquitination | LKLQMEFKAVQQVQR CCHHHHHHHHHHHHC | 34.05 | 21906983 | |
| 96 | Phosphorylation | VQRLPFLSSSNLSLD HHCCCCCCCCCCCEE | 31.90 | 25850435 | |
| 97 | Phosphorylation | QRLPFLSSSNLSLDV HCCCCCCCCCCCEEE | 25.95 | 25850435 | |
| 98 | Phosphorylation | RLPFLSSSNLSLDVL CCCCCCCCCCCEEEE | 38.11 | 25850435 | |
| 101 | Phosphorylation | FLSSSNLSLDVLRGN CCCCCCCCEEEECCC | 27.12 | 26434776 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POMP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POMP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POMP_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| H00790 | Keratosis linearis with ichthyosis congenita and sclerosing keratoderma; KLICK syndrome | |||||
| OMIM Disease | ||||||
| 601952 | Keratosis linearis with ichthyosis congenita and sclerosing keratoderma (KLICK) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
