| UniProt ID | PSMG2_HUMAN | |
|---|---|---|
| UniProt AC | Q969U7 | |
| Protein Name | Proteasome assembly chaperone 2 | |
| Gene Name | PSMG2 {ECO:0000312|EMBL:AAH13356.1} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 264 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.. | |
| Protein Sequence | MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 84 | Malonylation | VYSLPSRKLVALQLR EECCCCHHHHHHHHH | 52.21 | 26320211 | |
| 97 | Phosphorylation | LRSIFIKYKSKPFCE HHHHHHHHCCCHHHH | 18.71 | 28152594 | |
| 99 | Phosphorylation | SIFIKYKSKPFCEKL HHHHHHCCCHHHHHH | 42.33 | 28152594 | |
| 111 | Ubiquitination | EKLLSWVKSSGCARV HHHHHHHHHCCCEEE | 32.42 | 21906983 | |
| 122 | Phosphorylation | CARVIVLSSSHSYQR CEEEEEECCCCCCCC | 20.92 | 20068231 | |
| 123 | Phosphorylation | ARVIVLSSSHSYQRN EEEEEECCCCCCCCC | 28.10 | 28152594 | |
| 124 | Phosphorylation | RVIVLSSSHSYQRND EEEEECCCCCCCCCC | 17.05 | 28152594 | |
| 126 | Phosphorylation | IVLSSSHSYQRNDLQ EEECCCCCCCCCCCC | 25.55 | 28152594 | |
| 127 | Phosphorylation | VLSSSHSYQRNDLQL EECCCCCCCCCCCCC | 13.18 | 28152594 | |
| 136 | Phosphorylation | RNDLQLRSTPFRYLL CCCCCCCCCCHHHHC | 49.37 | 21406692 | |
| 137 | Phosphorylation | NDLQLRSTPFRYLLT CCCCCCCCCHHHHCC | 21.73 | 21406692 | |
| 141 | Phosphorylation | LRSTPFRYLLTPSMQ CCCCCHHHHCCHHHH | 13.37 | 21406692 | |
| 144 | Phosphorylation | TPFRYLLTPSMQKSV CCHHHHCCHHHHHHH | 15.66 | 21406692 | |
| 146 | Phosphorylation | FRYLLTPSMQKSVQN HHHHCCHHHHHHHHH | 28.72 | 21406692 | |
| 149 | Ubiquitination | LLTPSMQKSVQNKIK HCCHHHHHHHHHHHH | 43.91 | 21890473 | |
| 149 | Acetylation | LLTPSMQKSVQNKIK HCCHHHHHHHHHHHH | 43.91 | 25953088 | |
| 149 | Ubiquitination | LLTPSMQKSVQNKIK HCCHHHHHHHHHHHH | 43.91 | 21890473 | |
| 150 | Phosphorylation | LTPSMQKSVQNKIKS CCHHHHHHHHHHHHH | 16.43 | 21406692 | |
| 154 | Ubiquitination | MQKSVQNKIKSLNWE HHHHHHHHHHHCCHH | 34.13 | - | |
| 154 | Acetylation | MQKSVQNKIKSLNWE HHHHHHHHHHHCCHH | 34.13 | 25953088 | |
| 154 | 2-Hydroxyisobutyrylation | MQKSVQNKIKSLNWE HHHHHHHHHHHCCHH | 34.13 | - | |
| 156 | Ubiquitination | KSVQNKIKSLNWEEM HHHHHHHHHCCHHHH | 50.96 | 21890473 | |
| 165 | Ubiquitination | LNWEEMEKSRCIPEI CCHHHHHHHCCCCCC | 41.72 | - | |
| 165 | Acetylation | LNWEEMEKSRCIPEI CCHHHHHHHCCCCCC | 41.72 | 25953088 | |
| 166 | Phosphorylation | NWEEMEKSRCIPEID CHHHHHHHCCCCCCC | 21.05 | 28555341 | |
| 188 | Ubiquitination | IPGGGITKTLYDESC ECCCCCCCEECCCCC | 34.31 | - | |
| 188 | Acetylation | IPGGGITKTLYDESC ECCCCCCCEECCCCC | 34.31 | 26051181 | |
| 246 | Ubiquitination | TVSASRWKIPSSWRL CCCHHHCCCCCHHHH | 43.56 | 21890473 | |
| 246 | Ubiquitination | TVSASRWKIPSSWRL CCCHHHCCCCCHHHH | 43.56 | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSMG2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSMG2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSMG2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...