| UniProt ID | PSMG4_HUMAN | |
|---|---|---|
| UniProt AC | Q5JS54 | |
| Protein Name | Proteasome assembly chaperone 4 | |
| Gene Name | PSMG4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 123 | |
| Subcellular Localization | ||
| Protein Description | Chaperone protein which promotes assembly of the 20S proteasome.. | |
| Protein Sequence | MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 94 | Phosphorylation | TNKQVFVSYNLQNTD CCCCEEEEEECCCCC | 9.24 | 24043423 | |
| 95 | Phosphorylation | NKQVFVSYNLQNTDS CCCEEEEEECCCCCC | 18.00 | 24043423 | |
| 100 | Phosphorylation | VSYNLQNTDSNFALL EEEECCCCCCCCHHH | 28.04 | 24043423 | |
| 102 | Phosphorylation | YNLQNTDSNFALLVE EECCCCCCCCHHHHH | 31.63 | 24043423 | |
| 113 | Ubiquitination | LLVENRIKEEMEAFP HHHHHHHHHHHHHCC | 44.37 | - | |
| 122 | Ubiquitination | EMEAFPEKF------ HHHHCCCCC------ | 57.52 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSMG4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSMG4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSMG4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PSMG4_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...