UniProt ID | PSMG3_HUMAN | |
---|---|---|
UniProt AC | Q9BT73 | |
Protein Name | Proteasome assembly chaperone 3 | |
Gene Name | PSMG3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 122 | |
Subcellular Localization | ||
Protein Description | Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.. | |
Protein Sequence | MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEDTPLVI -------CCCCCEEE | 10.70 | 22223895 | |
4 | Phosphorylation | ----MEDTPLVISKQ ----CCCCCEEEECC | 12.76 | 20068231 | |
9 | Phosphorylation | EDTPLVISKQKTEVV CCCCEEEECCCEEEE | 22.89 | 29514088 | |
12 | Ubiquitination | PLVISKQKTEVVCGV CEEEECCCEEEEECC | 50.84 | - | |
44 | Phosphorylation | TQFGKMGTLVSLEPS EECCCCCEEEEECCC | 22.08 | 20068231 | |
47 | Phosphorylation | GKMGTLVSLEPSSVA CCCCEEEEECCCCCC | 30.08 | 20068231 | |
55 | Phosphorylation | LEPSSVASDVSKPVL ECCCCCCCCCCCCEE | 36.07 | 25627689 | |
58 | Phosphorylation | SSVASDVSKPVLTTK CCCCCCCCCCEEEEE | 35.91 | 25627689 | |
59 | Ubiquitination | SVASDVSKPVLTTKV CCCCCCCCCEEEEEE | 38.71 | 21890473 | |
65 | Ubiquitination | SKPVLTTKVLLGQDE CCCEEEEEEECCCCC | 26.17 | - | |
104 | 2-Hydroxyisobutyrylation | LAVAVKDKSMEGLKA EEEEECCCCHHHHHH | 46.08 | - | |
105 | Phosphorylation | AVAVKDKSMEGLKAL EEEECCCCHHHHHHH | 32.00 | 24719451 | |
110 | Ubiquitination | DKSMEGLKALREVIR CCCHHHHHHHHHHHH | 57.12 | 21890473 | |
110 | Acetylation | DKSMEGLKALREVIR CCCHHHHHHHHHHHH | 57.12 | 25953088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSMG3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSMG3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSMG3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TAP2_HUMAN | TAP2 | physical | 21988832 | |
NMI_HUMAN | NMI | physical | 22863883 | |
GLYM_HUMAN | SHMT2 | physical | 22863883 | |
PSB1_HUMAN | PSMB1 | physical | 17189198 | |
PSB3_HUMAN | PSMB3 | physical | 17189198 | |
PSB5_HUMAN | PSMB5 | physical | 17189198 | |
PSB4_HUMAN | PSMB4 | physical | 17189198 | |
PSA2_HUMAN | PSMA2 | physical | 17189198 | |
PSA7_HUMAN | PSMA7 | physical | 17189198 | |
PSA6_HUMAN | PSMA6 | physical | 17189198 | |
PSA5_HUMAN | PSMA5 | physical | 17189198 | |
PSMG1_HUMAN | PSMG1 | physical | 17189198 | |
PSMG2_HUMAN | PSMG2 | physical | 17189198 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. |