UniProt ID | DS13A_HUMAN | |
---|---|---|
UniProt AC | Q6B8I1 | |
Protein Name | Dual specificity protein phosphatase 13 isoform A | |
Gene Name | DUSP13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 188 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Probable protein tyrosine phosphatase. Has phosphatase activity with synthetic substrates. [PubMed: 15252030] | |
Protein Sequence | MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
138 | Phosphorylation | VGVSRSATLVLAYLM HCCCHHHHHHHHHHH | 22210691 | ||
151 | Phosphorylation | LMLHQRLSLRQAVIT HHHHHHHHHHHHHHH | 22210691 | ||
238 | Phosphorylation | --------------------------------------------------------- --------------------------------------------------------- | 24719451 | ||
253 | Phosphorylation | ------------------------------------------------------------------------ ------------------------------------------------------------------------ | 24719451 | ||
260 | Phosphorylation | ------------------------------------------------------------------------------- ------------------------------------------------------------------------------- | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DS13A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DS13A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DS13A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...