UniProt ID | CCS_HUMAN | |
---|---|---|
UniProt AC | O14618 | |
Protein Name | Copper chaperone for superoxide dismutase | |
Gene Name | CCS | |
Organism | Homo sapiens (Human). | |
Sequence Length | 274 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Delivers copper to copper zinc superoxide dismutase (SOD1).. | |
Protein Sequence | MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
76 | Ubiquitination | TGRQAVLKGMGSGQL CCHHHHHCCCCCHHH | 40.01 | 20154138 | |
109 | Phosphorylation | VVRFLQLTPERCLIE HHHHHHCCCCCEEEE | 15.33 | 26270265 | |
165 | Methylation | PQDSDRHRGDLGNVR CCCCCCCCCCCCCCE | 41.01 | - | |
189 | Ubiquitination | RMEDEQLKVWDVIGR EECHHHHEEEEEECC | 40.76 | 20154138 | |
209 | Methylation | EGEDDLGRGGHPLSK CCCCCCCCCCCCCHH | 56.04 | - | |
216 | Ubiquitination | RGGHPLSKITGNSGE CCCCCCHHHCCCCCC | 52.55 | 20154138 | |
241 | Ubiquitination | AGLFQNPKQICSCDG CCCCCCHHHEECCCC | 60.90 | 2015413 | |
245 | Phosphorylation | QNPKQICSCDGLTIW CCHHHEECCCCEEEE | 19.51 | 28348404 | |
267 | Phosphorylation | AGKGRKESAQPPAHL CCCCCHHCCCCCCCC | 34.93 | 15736924 |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
241 | K | ubiquitylation |
| 20154138 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCS_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SODC_HUMAN | SOD1 | physical | 9726962 | |
APBA1_HUMAN | APBA1 | physical | 11115513 | |
CCS_HUMAN | CCS | physical | 10677207 | |
XIAP_HUMAN | XIAP | physical | 20154138 | |
SODC_HUMAN | SOD1 | physical | 12968035 | |
ATOX1_HUMAN | ATOX1 | physical | 26344197 | |
PPIL3_HUMAN | PPIL3 | physical | 26344197 | |
RAE1L_HUMAN | RAE1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global proteomic profiling of phosphopeptides using electron transferdissociation tandem mass spectrometry."; Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A.; Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-267, AND MASSSPECTROMETRY. | |
Ubiquitylation | |
Reference | PubMed |
"Regulation of the copper chaperone CCS by XIAP-mediatedubiquitination."; Brady G.F., Galban S., Liu X., Basrur V., Gitlin J.D.,Elenitoba-Johnson K.S., Wilson T.E., Duckett C.S.; Mol. Cell. Biol. 30:1923-1936(2010). Cited for: UBIQUITINATION AT LYS-76; LYS-189; LYS-216 AND LYS-241 BY XIAP/BIRC4,AND INTERACTION WITH XIAP/BIRC4. |