UniProt ID | DS13B_HUMAN | |
---|---|---|
UniProt AC | Q9UII6 | |
Protein Name | Dual specificity protein phosphatase 13 isoform B | |
Gene Name | DUSP13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 198 | |
Subcellular Localization | ||
Protein Description | Dual specificity phosphatase that dephosphorylates MAPK8/JNK and MAPK14/p38, but not MAPK1/ERK2, in vitro. Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues, with similar specific activities in vitro.. | |
Protein Sequence | MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
122 | Phosphorylation | YFLPVARYIRAALSV EHHHHHHHHHHHHCC | - | ||
145 | Phosphorylation | CAMGVSRSATLVLAF HCCCCCHHHHHHHHH | 24719451 | ||
160 | Phosphorylation | LMICENMTLVEAIQT HHHHCCCCHHHHHHH | 24719451 | ||
167 | Phosphorylation | TLVEAIQTVQAHRNI CHHHHHHHHHHHHCC | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DS13B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DS13B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DS13B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...