UniProt ID | ACOT9_HUMAN | |
---|---|---|
UniProt AC | Q9Y305 | |
Protein Name | Acyl-coenzyme A thioesterase 9, mitochondrial | |
Gene Name | ACOT9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 439 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Active on long chain acyl-CoAs.. | |
Protein Sequence | MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVEVGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQRHFNSMSGPATLRKDYLVEP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MRRAALRLCALG ---CCHHHHHHHHCC | 7.45 | 21890473 | |
13 | Ubiquitination | LRLCALGKGQLTPGR HHHHHCCCCCCCCCC | 44.31 | 21890473 | |
13 (in isoform 3) | Ubiquitination | - | 44.31 | 21890473 | |
23 | Phosphorylation | LTPGRGLTQGPQNPK CCCCCCCCCCCCCCC | 34.01 | 46157931 | |
26 (in isoform 2) | Ubiquitination | - | 22.43 | 21890473 | |
32 (in isoform 2) | Ubiquitination | - | 57.23 | 21890473 | |
40 (in isoform 2) | Ubiquitination | - | 6.24 | 21890473 | |
59 | Ubiquitination | TNWRDHVKAMEERKL CCHHHHHHHHHHHHH | 38.30 | 22817900 | |
59 (in isoform 1) | Ubiquitination | - | 38.30 | 21890473 | |
65 | Ubiquitination | VKAMEERKLLHSFLA HHHHHHHHHHHHHHH | 59.69 | 22817900 | |
65 (in isoform 1) | Ubiquitination | - | 59.69 | 21890473 | |
68 | Ubiquitination | MEERKLLHSFLAKSQ HHHHHHHHHHHHHCC | 27.26 | 21890473 | |
68 (in isoform 4) | Ubiquitination | - | 27.26 | - | |
69 | Phosphorylation | EERKLLHSFLAKSQD HHHHHHHHHHHHCCC | 23.17 | 24719451 | |
73 | Ubiquitination | LLHSFLAKSQDGLPP HHHHHHHHCCCCCCC | 51.28 | 73 | |
73 (in isoform 1) | Ubiquitination | - | 51.28 | 21890473 | |
74 | Ubiquitination | LHSFLAKSQDGLPPR HHHHHHHCCCCCCCC | 28.09 | 21890473 | |
74 (in isoform 4) | Ubiquitination | - | 28.09 | - | |
78 | Ubiquitination | LAKSQDGLPPRRMKD HHHCCCCCCCCCCCC | 7.69 | 21890473 | |
78 (in isoform 3) | Ubiquitination | - | 7.69 | 21890473 | |
82 | Ubiquitination | QDGLPPRRMKDSYIE CCCCCCCCCCCCEEE | 42.13 | 21890473 | |
82 (in isoform 4) | Ubiquitination | - | 42.13 | - | |
87 | Phosphorylation | PRRMKDSYIEVLLPL CCCCCCCEEEEEEEC | 15.96 | 83553 | |
96 | Phosphorylation | EVLLPLGSEPELREK EEEEECCCCHHHHHH | 58.63 | 108430773 | |
97 | Ubiquitination | VLLPLGSEPELREKY EEEECCCCHHHHHHH | 40.78 | 29967540 | |
103 | Acetylation | SEPELREKYLTVQNT CCHHHHHHHEECCCH | 38.84 | 19608861 | |
103 | Malonylation | SEPELREKYLTVQNT CCHHHHHHHEECCCH | 38.84 | 26320211 | |
103 | Succinylation | SEPELREKYLTVQNT CCHHHHHHHEECCCH | 38.84 | 27452117 | |
104 | Phosphorylation | EPELREKYLTVQNTV CHHHHHHHEECCCHH | 11.67 | 55817215 | |
105 (in isoform 2) | Ubiquitination | - | 5.83 | 21890473 | |
106 | Phosphorylation | ELREKYLTVQNTVRF HHHHHHEECCCHHHH | 19.56 | 20639409 | |
110 | Phosphorylation | KYLTVQNTVRFGRIL HHEECCCHHHHHHHH | 8.93 | 20639409 | |
112 | Acetylation | LTVQNTVRFGRILED EECCCHHHHHHHHHH | 26.68 | 19608861 | |
122 | Phosphorylation | RILEDLDSLGVLICY HHHHHHHHHCHHHHH | 34.03 | 29083192 | |
129 | Phosphorylation | SLGVLICYMHNKIHS HHCHHHHHHHCCHHC | 8.40 | 29083192 | |
133 | Ubiquitination | LICYMHNKIHSAKMS HHHHHHCCHHCCCCC | 27.41 | 22817900 | |
138 | Ubiquitination | HNKIHSAKMSPLSIV HCCHHCCCCCHHHHH | 42.81 | 21890473 | |
138 (in isoform 1) | Ubiquitination | - | 42.81 | 21890473 | |
142 | Ubiquitination | HSAKMSPLSIVTALV HCCCCCHHHHHHHHH | 4.24 | 22817900 | |
147 | Ubiquitination | SPLSIVTALVDKIDM CHHHHHHHHHHHHHH | 8.49 | 21890473 | |
147 (in isoform 4) | Ubiquitination | - | 8.49 | - | |
151 | Ubiquitination | IVTALVDKIDMCKKS HHHHHHHHHHHHCCC | 32.88 | 21963094 | |
151 (in isoform 3) | Ubiquitination | - | 32.88 | 21890473 | |
156 | Acetylation | VDKIDMCKKSLSPEQ HHHHHHHCCCCCHHH | 38.47 | 7406693 | |
157 | Acetylation | DKIDMCKKSLSPEQD HHHHHHCCCCCHHHC | 52.26 | 19608861 | |
157 | Malonylation | DKIDMCKKSLSPEQD HHHHHHCCCCCHHHC | 52.26 | 26320211 | |
157 | Succinylation | DKIDMCKKSLSPEQD HHHHHHCCCCCHHHC | 52.26 | 27452117 | |
157 | Ubiquitination | DKIDMCKKSLSPEQD HHHHHHCCCCCHHHC | 52.26 | 19608861 | |
158 | Phosphorylation | KIDMCKKSLSPEQDI HHHHHCCCCCHHHCC | 21.41 | 23312004 | |
160 | Phosphorylation | DMCKKSLSPEQDIKF HHHCCCCCHHHCCEE | 33.22 | 21815630 | |
166 | Acetylation | LSPEQDIKFSGHVSW CCHHHCCEECEEEEE | 41.59 | 30585521 | |
166 | Ubiquitination | LSPEQDIKFSGHVSW CCHHHCCEECEEEEE | 41.59 | 29967540 | |
177 | Ubiquitination | HVSWVGKTSMEVKMQ EEEECCCCCHHHHHH | 27.64 | 27667366 | |
178 (in isoform 2) | Ubiquitination | - | 19.21 | 21890473 | |
190 | Ubiquitination | MQMFQLHGDEFCPVL HHHHHHHCCCCCCCC | 44.74 | 21890473 | |
190 (in isoform 3) | Ubiquitination | - | 44.74 | 21890473 | |
211 | Ubiquitination | VARDSENKGPAFVNP EEECCCCCCCCCCCC | 63.32 | 21906983 | |
211 (in isoform 1) | Ubiquitination | - | 63.32 | 21890473 | |
212 | Ubiquitination | ARDSENKGPAFVNPL EECCCCCCCCCCCCC | 30.28 | 21890473 | |
212 (in isoform 3) | Ubiquitination | - | 30.28 | 21890473 | |
217 (in isoform 2) | Ubiquitination | - | 21.14 | 21890473 | |
220 | Ubiquitination | PAFVNPLIPESPEEE CCCCCCCCCCCHHHH | 3.62 | 21963094 | |
223 | Phosphorylation | VNPLIPESPEEEELF CCCCCCCCHHHHHHH | 32.05 | 26657352 | |
232 (in isoform 4) | Phosphorylation | - | 42.24 | 27251275 | |
237 | Ubiquitination | FRQGELNKGRRIAFS HHCCCCCCCCEEEEE | 67.43 | 27667366 | |
239 (in isoform 2) | Ubiquitination | - | 28.57 | 21890473 | |
244 | Phosphorylation | KGRRIAFSSTSLLKM CCCEEEEECHHHHHC | 24.55 | 21406692 | |
245 | Phosphorylation | GRRIAFSSTSLLKMA CCEEEEECHHHHHCC | 18.63 | 21406692 | |
246 | Phosphorylation | RRIAFSSTSLLKMAP CEEEEECHHHHHCCC | 23.38 | 21406692 | |
246 | Ubiquitination | RRIAFSSTSLLKMAP CEEEEECHHHHHCCC | 23.38 | 27667366 | |
247 | Phosphorylation | RIAFSSTSLLKMAPS EEEEECHHHHHCCCC | 33.38 | 30576142 | |
250 | Acetylation | FSSTSLLKMAPSAEE EECHHHHHCCCCHHH | 38.01 | 19608861 | |
250 | Ubiquitination | FSSTSLLKMAPSAEE EECHHHHHCCCCHHH | 38.01 | 22817900 | |
250 (in isoform 1) | Ubiquitination | - | 38.01 | 21890473 | |
259 | Acetylation | APSAEERTTIHEMFL CCCHHHCCCHHHHHH | 33.12 | 19608861 | |
259 | Ubiquitination | APSAEERTTIHEMFL CCCHHHCCCHHHHHH | 33.12 | 21890473 | |
259 (in isoform 4) | Ubiquitination | - | 33.12 | - | |
272 | Acetylation | FLSTLDPKTISFRSR HHHCCCCCCCEECCC | 59.15 | 23236377 | |
272 | Ubiquitination | FLSTLDPKTISFRSR HHHCCCCCCCEECCC | 59.15 | 22817900 | |
272 (in isoform 1) | Ubiquitination | - | 59.15 | 21890473 | |
273 | Phosphorylation | LSTLDPKTISFRSRV HHCCCCCCCEECCCC | 27.52 | 23927012 | |
275 | Phosphorylation | TLDPKTISFRSRVLP CCCCCCCEECCCCCC | 21.60 | 29496963 | |
278 | Phosphorylation | PKTISFRSRVLPSNA CCCCEECCCCCCCCC | 25.40 | 29978859 | |
281 | Ubiquitination | ISFRSRVLPSNAVWM CEECCCCCCCCCEEE | 3.60 | 21890473 | |
281 (in isoform 4) | Ubiquitination | - | 3.60 | - | |
283 | Phosphorylation | FRSRVLPSNAVWMEN ECCCCCCCCCEEECC | 33.01 | 29978859 | |
284 (in isoform 4) | Phosphorylation | - | 36.25 | 24719451 | |
292 | Acetylation | AVWMENSKLKSLEIC CEEECCCCCCCCEEC | 72.08 | 25825284 | |
294 | Malonylation | WMENSKLKSLEICHP EECCCCCCCCEECCH | 57.65 | 26320211 | |
294 | Succinylation | WMENSKLKSLEICHP EECCCCCCCCEECCH | 57.65 | 27452117 | |
347 | Ubiquitination | VDDIMFQKPVEVGSL EEHHEECCCCCCCCE | 39.50 | 23503661 | |
374 (in isoform 2) | Ubiquitination | - | 14.00 | - | |
375 | Phosphorylation | YIQVRVHSEVASLQE EEEEEEEHHHHHHHH | 30.80 | 37817017 | |
379 | Phosphorylation | RVHSEVASLQEKQHT EEEHHHHHHHHCEEC | 35.44 | 21406692 | |
386 | Phosphorylation | SLQEKQHTTTNVFHF HHHHCEECCCCEEEE | 32.59 | 110760849 | |
407 | Acetylation | EVPLVFPKTYGESML CCCEEECCCCCCCEE | 42.80 | 23954790 | |
407 | Malonylation | EVPLVFPKTYGESML CCCEEECCCCCCCEE | 42.80 | 26320211 | |
407 | Succinylation | EVPLVFPKTYGESML CCCEEECCCCCCCEE | 42.80 | 27452117 | |
407 | Ubiquitination | EVPLVFPKTYGESML CCCEEECCCCCCCEE | 42.80 | 23503661 | |
416 | Acetylation | YGESMLYLDGQRHFN CCCCEEEECCCCCCC | 5.41 | 19608861 | |
416 | Ubiquitination | YGESMLYLDGQRHFN CCCCEEEECCCCCCC | 5.41 | 23503661 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACOT9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACOT9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACOT9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ACOT9_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-103; LYS-157; LYS-250 ANDLYS-407, AND MASS SPECTROMETRY. |