dbPTM

NFU1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NFU1_HUMAN
UniProt AC	Q9UMS0
Protein Name	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
Gene Name	NFU1
Organism	Homo sapiens (Human).
Sequence Length	254
Subcellular Localization	Mitochondrion. Cytoplasm, cytosol.
Protein Description	Iron-sulfur cluster scaffold protein which can assemble [4Fe-2S] clusters and deliver them to target proteins..
Protein Sequence	MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Methylation	-MAATARRGWGAAAV -CCCCCCCCHHHHHH	42.63	54557651
78	Malonylation	SLKFIPGKPVLETRT CCCCCCCCEEEEEEE	26.97	26320211
84	Methylation	GKPVLETRTMDFPTP CCEEEEEEECCCCCH	20.76	115484955
85	Phosphorylation	KPVLETRTMDFPTPA CEEEEEEECCCCCHH	28.63	28348404
86	Sulfoxidation	PVLETRTMDFPTPAA EEEEEEECCCCCHHH	4.51	21406390
90	Phosphorylation	TRTMDFPTPAAAFRS EEECCCCCHHHHHCC	26.08	28348404
97	Phosphorylation	TPAAAFRSPLARQLF CHHHHHCCHHHHHHH	20.15	28348404
163	Phosphorylation	TPSGEAGSEEDDEVV CCCCCCCCCCHHHHH	44.88	24275569
194	Phosphorylation	EDGGDVIYKGFEDGI ECCCCEEEECCCCCE	12.61	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NFU1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NFU1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NFU1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
HIRA_HUMAN	HIRA	physical	11342215
ATRAP_HUMAN	AGTRAP	physical	25416956

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NFU1_HUMAN

Related Literatures of Post-Translational Modification