UniProt ID | NFU1_HUMAN | |
---|---|---|
UniProt AC | Q9UMS0 | |
Protein Name | NFU1 iron-sulfur cluster scaffold homolog, mitochondrial | |
Gene Name | NFU1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 254 | |
Subcellular Localization | Mitochondrion. Cytoplasm, cytosol. | |
Protein Description | Iron-sulfur cluster scaffold protein which can assemble [4Fe-2S] clusters and deliver them to target proteins.. | |
Protein Sequence | MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Methylation | -MAATARRGWGAAAV -CCCCCCCCHHHHHH | 42.63 | 54557651 | |
78 | Malonylation | SLKFIPGKPVLETRT CCCCCCCCEEEEEEE | 26.97 | 26320211 | |
84 | Methylation | GKPVLETRTMDFPTP CCEEEEEEECCCCCH | 20.76 | 115484955 | |
85 | Phosphorylation | KPVLETRTMDFPTPA CEEEEEEECCCCCHH | 28.63 | 28348404 | |
86 | Sulfoxidation | PVLETRTMDFPTPAA EEEEEEECCCCCHHH | 4.51 | 21406390 | |
90 | Phosphorylation | TRTMDFPTPAAAFRS EEECCCCCHHHHHCC | 26.08 | 28348404 | |
97 | Phosphorylation | TPAAAFRSPLARQLF CHHHHHCCHHHHHHH | 20.15 | 28348404 | |
163 | Phosphorylation | TPSGEAGSEEDDEVV CCCCCCCCCCHHHHH | 44.88 | 24275569 | |
194 | Phosphorylation | EDGGDVIYKGFEDGI ECCCCEEEECCCCCE | 12.61 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NFU1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NFU1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NFU1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HIRA_HUMAN | HIRA | physical | 11342215 | |
ATRAP_HUMAN | AGTRAP | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...