UniProt ID | LACRT_HUMAN | |
---|---|---|
UniProt AC | Q9GZZ8 | |
Protein Name | Extracellular glycoprotein lacritin | |
Gene Name | LACRT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 138 | |
Subcellular Localization | Secreted. | |
Protein Description | Modulates secretion by lacrimal acinar cells.. | |
Protein Sequence | MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
75 | O-linked_Glycosylation | VQGTAKVTSSRQELN HHCCEEECCCCHHHC | 21.93 | 55829599 | |
76 | O-linked_Glycosylation | QGTAKVTSSRQELNP HCCEEECCCCHHHCC | 26.89 | 55829603 | |
77 | O-linked_Glycosylation | GTAKVTSSRQELNPL CCEEECCCCHHHCCH | 28.72 | 55829607 | |
119 | N-linked_Glycosylation | GGKQFIENGSEFAQK CHHHHHHCHHHHHHH | 55.25 | 16740002 | |
121 | Phosphorylation | KQFIENGSEFAQKLL HHHHHCHHHHHHHHH | 40.91 | - | |
132 | Phosphorylation | QKLLKKFSLLKPWA- HHHHHHHCCCCCCC- | 41.49 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LACRT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LACRT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LACRT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SDC1_HUMAN | SDC1 | physical | 16982797 | |
VTNC_HUMAN | VTN | physical | 11419941 | |
FINC_HUMAN | FN1 | physical | 11419941 | |
NID1_HUMAN | NID1 | physical | 11419941 | |
A4_HUMAN | APP | physical | 21832049 | |
SDC1_HUMAN | SDC1 | physical | 23504321 | |
TGM2_HUMAN | TGM2 | physical | 23425695 | |
PLXA2_HUMAN | PLXNA2 | physical | 28514442 | |
PCYXL_HUMAN | PCYOX1L | physical | 28514442 | |
ARSK_HUMAN | ARSK | physical | 28514442 | |
K319L_HUMAN | KIAA0319L | physical | 28514442 | |
NDST2_HUMAN | NDST2 | physical | 28514442 | |
EMC4_HUMAN | EMC4 | physical | 28514442 | |
SELN_HUMAN | SEPN1 | physical | 28514442 | |
ACOX1_HUMAN | ACOX1 | physical | 28514442 | |
RN114_HUMAN | RNF114 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Identification of N-linked glycoproteins in human saliva byglycoprotein capture and mass spectrometry."; Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T.,Loo J.A.; J. Proteome Res. 5:1493-1503(2006). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-119, AND MASSSPECTROMETRY. |