| UniProt ID | SELN_HUMAN | |
|---|---|---|
| UniProt AC | Q9NZV5 | |
| Protein Name | Selenoprotein N {ECO:0000303|PubMed:27645994} | |
| Gene Name | SELENON {ECO:0000303|PubMed:27645994, ECO:0000312|HGNC:HGNC:15999} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 590 | |
| Subcellular Localization | Isoform 2: Endoplasmic reticulum membrane . | |
| Protein Description | Isoform 2: Plays an important role in cell protection against oxidative stress and in the regulation of redox-related calcium homeostasis. Regulates the calcium level of the ER by protecting the calcium pump ATP2A2 against the oxidoreductase ERO1A-mediated oxidative damage. Within the ER, ERO1A activity increases the concentration of H(2)O(2), which attacks the luminal thiols in ATP2A2 and thus leads to cysteinyl sulfenic acid formation (-SOH) and SEPN1 reduces the SOH back to free thiol (-SH), thus restoring ATP2A2 activity. [PubMed: 25452428 Acts as a modulator of ryanodine receptor (RyR) activity: protects RyR from oxidation due to increased oxidative stress, or directly controls the RyR redox state, regulating the RyR-mediated calcium mobilization required for normal muscle development and differentiation] | |
| Protein Sequence | MGRARPGQRGPPSPGPAAQPPAPPRRRARSLALLGALLAAAAAAAVRVCARHAEAQAAARQELALKTLGTDGLFLFSSLDTDGDMYISPEEFKPIAEKLTGSCSVTQTGVQWCSHSSLQPQLPWLNUSSCLSLLRSTPAASCEEEELPPDPSEETLTIEARFQPLLPETMTKSKDGFLGVSRLALSGLRNWTAAASPSAVFATRHFQPFLPPPGQELGEPWWIIPSELSMFTGYLSNNRFYPPPPKGKEVIIHRLLSMFHPRPFVKTRFAPQGAVACLTAISDFYYTVMFRIHAEFQLSEPPDFPFWFSPAQFTGHIILSKDATHVRDFRLFVPNHRSLNVDMEWLYGASESSNMEVDIGYIPQMELEATGPSVPSVILDEDGSMIDSHLPSGEPLQFVFEEIKWQQELSWEEAARRLEVAMYPFKKVSYLPFTEAFDRAKAENKLVHSILLWGALDDQSCUGSGRTLRETVLESSPILTLLNESFISTWSLVKELEELQNNQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINANYFLDITSVKPEEIESNLFSFSSTFEDPSTATYMQFLKEGLRRGLPLLQP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Phosphorylation | PGQRGPPSPGPAAQP CCCCCCCCCCCCCCC | 45.69 | 29255136 | |
| 30 | Phosphorylation | PPRRRARSLALLGAL CCCHHHHHHHHHHHH | 19.60 | 28450419 | |
| 107 (in isoform 2) | Phosphorylation | - | 33.82 | - | |
| 126 | N-linked_Glycosylation | QPQLPWLNUSSCLSL CCCCCCCCHHHHHHH | 39.90 | UniProtKB CARBOHYD | |
| 138 (in isoform 2) | Ubiquitination | - | 27.37 | 21906983 | |
| 138 | Ubiquitination | LSLLRSTPAASCEEE HHHHHCCCCCCCCCC | 27.37 | 29967540 | |
| 140 | Ubiquitination | LLRSTPAASCEEEEL HHHCCCCCCCCCCCC | 18.87 | 27667366 | |
| 152 | Phosphorylation | EELPPDPSEETLTIE CCCCCCCCCCCEEEE | 56.28 | 29759185 | |
| 172 | Ubiquitination | LLPETMTKSKDGFLG CCCCHHCCCCCCCCH | 44.69 | 21906983 | |
| 174 (in isoform 1) | Ubiquitination | - | 64.52 | 21906983 | |
| 174 | Ubiquitination | PETMTKSKDGFLGVS CCHHCCCCCCCCHHH | 64.52 | 27667366 | |
| 186 | Phosphorylation | GVSRLALSGLRNWTA HHHHHHHHHHCCCCC | 30.12 | 24719451 | |
| 190 | N-linked_Glycosylation | LALSGLRNWTAAASP HHHHHHCCCCCCCCH | 45.55 | UniProtKB CARBOHYD | |
| 212 | Ubiquitination | HFQPFLPPPGQELGE CCCCCCCCCCCCCCC | 48.04 | 27667366 | |
| 241 | Phosphorylation | YLSNNRFYPPPPKGK CCCCCCCCCCCCCCC | 16.16 | 23403867 | |
| 246 | Ubiquitination | RFYPPPPKGKEVIIH CCCCCCCCCCHHHHH | 84.28 | 27667366 | |
| 267 | O-linked_Glycosylation | HPRPFVKTRFAPQGA CCCCCCCCCCCCHHH | 26.22 | 29237092 | |
| 267 | Phosphorylation | HPRPFVKTRFAPQGA CCCCCCCCCCCCHHH | 26.22 | 26356563 | |
| 393 (in isoform 2) | Ubiquitination | - | 38.30 | 21906983 | |
| 423 | Phosphorylation | RRLEVAMYPFKKVSY HHHHHHCCCCCCCCC | 8.86 | 28509920 | |
| 427 | Ubiquitination | VAMYPFKKVSYLPFT HHCCCCCCCCCCCCH | 36.47 | 2190698 | |
| 429 (in isoform 1) | Ubiquitination | - | 29.81 | 21906983 | |
| 483 | N-linked_Glycosylation | SPILTLLNESFISTW CHHHHHHCHHHHHHH | 46.08 | UniProtKB CARBOHYD | |
| 505 | N-linked_Glycosylation | ELQNNQENSSHQKLA HHHHCCCCCHHHHHH | 38.76 | UniProtKB CARBOHYD | |
| 531 | N-linked_Glycosylation | EMMICLPNGTVVHHI EEEEECCCCEEEEEE | 45.91 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SELN_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SELN_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SELN_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SELN_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| H00590 | Congenital muscular dystrophies (CMD/MDC), including: Merosin-deficient CMD (MDC1A); Ullrich CMD (UC | |||||
| H00701 | Congenital fiber type disproportion (CFTD) | |||||
| H01310 | Multi-minicore disease (MmD); Multicore myopathy with external ophthalmoplegia | |||||
| OMIM Disease | ||||||
| 602771 | Rigid spine muscular dystrophy 1 (RSMD1) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
