| UniProt ID | ARSK_HUMAN | |
|---|---|---|
| UniProt AC | Q6UWY0 | |
| Protein Name | Arylsulfatase K | |
| Gene Name | ARSK | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 536 | |
| Subcellular Localization | Secreted . | |
| Protein Description | ||
| Protein Sequence | MLLLWVSVVAALALAVLAPGAGEQRRRAAKAPNVVLVVSDSFDGRLTFHPGSQVVKLPFINFMKTRGTSFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDVMERHGYRTQKFGKLDYTSGHHSISNRVEAWTRDVAFLLRQEGRPMVNLIRNRTKVRVMERDWQNTDKAVNWLRKEAINYTEPFVIYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVSHDAIKIPKWSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYYAMCAETDAMLGEIILALHQLDLLQKTIVIYSSDHGELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAGLQVSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLPLSSETFKNEHKVKNLHPPWILSEFHGCNVNASTYMLRTNHWKYIAYSDGASILPQLFDLSSDPDELTNVAVKFPEITYSLDQKLHSIINYPKVSASVHQYNKEQFIKWKQSIGQNYSNVIANLRWHQDWQKEPRKYENAIDQWLKTHMNPRAV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | Ubiquitination | EQRRRAAKAPNVVLV HHHHHHHHCCCEEEE | 64.49 | - | |
| 74 | Phosphorylation | GTSFLNAYTNSPICC CCCHHHHHCCCCCCC | 12.84 | 22817900 | |
| 80 | Oxidation | AYTNSPICCPSRAAM HHCCCCCCCCCHHHH | 2.95 | - | |
| 80 | 3-oxoalanine (Cys) | AYTNSPICCPSRAAM HHCCCCCCCCCHHHH | 2.95 | - | |
| 108 | N-linked_Glycosylation | NFKGLDPNYTTWMDV HCCCCCCCCCCHHHH | 46.58 | UniProtKB CARBOHYD | |
| 166 | N-linked_Glycosylation | PMVNLIRNRTKVRVM CHHHHHCCCCEEEEE | 49.32 | UniProtKB CARBOHYD | |
| 182 | Ubiquitination | RDWQNTDKAVNWLRK CCCCCHHHHHHHHHH | 52.80 | 29967540 | |
| 193 | N-linked_Glycosylation | WLRKEAINYTEPFVI HHHHHHCCCCCCEEE | 44.73 | UniProtKB CARBOHYD | |
| 240 | Ubiquitination | KVSHDAIKIPKWSPL HCCCCCCCCCCCCCH | 55.46 | 29967540 | |
| 243 | Ubiquitination | HDAIKIPKWSPLSEM CCCCCCCCCCCHHHC | 64.87 | 29967540 | |
| 245 | Phosphorylation | AIKIPKWSPLSEMHP CCCCCCCCCHHHCCC | 23.30 | - | |
| 262 | N-linked_Glycosylation | YYSSYTKNCTGRFTK CHHCCCCCCCCCCCH | 22.30 | UniProtKB CARBOHYD | |
| 375 | N-linked_Glycosylation | AGIPLPQNLSGYSLL CCCCCCCCCCCCCEE | 33.95 | UniProtKB CARBOHYD | |
| 413 | N-linked_Glycosylation | EFHGCNVNASTYMLR HHCCCCCCCCEEEEC | 17.74 | UniProtKB CARBOHYD | |
| 434 | Phosphorylation | IAYSDGASILPQLFD EEECCCCCHHHHHHC | 30.13 | 19690332 | |
| 450 | Phosphorylation | SSDPDELTNVAVKFP CCCHHHHHHHHHCCC | 26.12 | 19690332 | |
| 498 | N-linked_Glycosylation | WKQSIGQNYSNVIAN HHHHHCCCCCHHHHH | 36.67 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARSK_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARSK_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARSK_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARSK_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
