UniProt ID | ARSK_HUMAN | |
---|---|---|
UniProt AC | Q6UWY0 | |
Protein Name | Arylsulfatase K | |
Gene Name | ARSK | |
Organism | Homo sapiens (Human). | |
Sequence Length | 536 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MLLLWVSVVAALALAVLAPGAGEQRRRAAKAPNVVLVVSDSFDGRLTFHPGSQVVKLPFINFMKTRGTSFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDVMERHGYRTQKFGKLDYTSGHHSISNRVEAWTRDVAFLLRQEGRPMVNLIRNRTKVRVMERDWQNTDKAVNWLRKEAINYTEPFVIYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVSHDAIKIPKWSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYYAMCAETDAMLGEIILALHQLDLLQKTIVIYSSDHGELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAGLQVSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLPLSSETFKNEHKVKNLHPPWILSEFHGCNVNASTYMLRTNHWKYIAYSDGASILPQLFDLSSDPDELTNVAVKFPEITYSLDQKLHSIINYPKVSASVHQYNKEQFIKWKQSIGQNYSNVIANLRWHQDWQKEPRKYENAIDQWLKTHMNPRAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Ubiquitination | EQRRRAAKAPNVVLV HHHHHHHHCCCEEEE | 64.49 | - | |
74 | Phosphorylation | GTSFLNAYTNSPICC CCCHHHHHCCCCCCC | 12.84 | 22817900 | |
80 | Oxidation | AYTNSPICCPSRAAM HHCCCCCCCCCHHHH | 2.95 | - | |
80 | 3-oxoalanine (Cys) | AYTNSPICCPSRAAM HHCCCCCCCCCHHHH | 2.95 | - | |
108 | N-linked_Glycosylation | NFKGLDPNYTTWMDV HCCCCCCCCCCHHHH | 46.58 | UniProtKB CARBOHYD | |
166 | N-linked_Glycosylation | PMVNLIRNRTKVRVM CHHHHHCCCCEEEEE | 49.32 | UniProtKB CARBOHYD | |
182 | Ubiquitination | RDWQNTDKAVNWLRK CCCCCHHHHHHHHHH | 52.80 | 29967540 | |
193 | N-linked_Glycosylation | WLRKEAINYTEPFVI HHHHHHCCCCCCEEE | 44.73 | UniProtKB CARBOHYD | |
240 | Ubiquitination | KVSHDAIKIPKWSPL HCCCCCCCCCCCCCH | 55.46 | 29967540 | |
243 | Ubiquitination | HDAIKIPKWSPLSEM CCCCCCCCCCCHHHC | 64.87 | 29967540 | |
245 | Phosphorylation | AIKIPKWSPLSEMHP CCCCCCCCCHHHCCC | 23.30 | - | |
262 | N-linked_Glycosylation | YYSSYTKNCTGRFTK CHHCCCCCCCCCCCH | 22.30 | UniProtKB CARBOHYD | |
375 | N-linked_Glycosylation | AGIPLPQNLSGYSLL CCCCCCCCCCCCCEE | 33.95 | UniProtKB CARBOHYD | |
413 | N-linked_Glycosylation | EFHGCNVNASTYMLR HHCCCCCCCCEEEEC | 17.74 | UniProtKB CARBOHYD | |
434 | Phosphorylation | IAYSDGASILPQLFD EEECCCCCHHHHHHC | 30.13 | 19690332 | |
450 | Phosphorylation | SSDPDELTNVAVKFP CCCHHHHHHHHHCCC | 26.12 | 19690332 | |
498 | N-linked_Glycosylation | WKQSIGQNYSNVIAN HHHHHCCCCCHHHHH | 36.67 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARSK_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARSK_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARSK_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARSK_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...