KAD6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KAD6_HUMAN
• UniProt AC: Q9Y3D8
• Protein Name: Adenylate kinase isoenzyme 6 {ECO:0000255|HAMAP-Rule:MF_03173}
• Gene Name: AK6 {ECO:0000255|HAMAP-Rule:MF_03173}
• Organism: Homo sapiens (Human).
• Sequence Length: 172
• Subcellular Localization: Nucleus, nucleoplasm. Nucleus, Cajal body. Displays widespread diffuse nucleoplasmic distribution but not detected in nucleoli. Detected in Cajal bodies but not in all cells.
• Protein Description: Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. AMP and dAMP are the preferred substrates, but CMP and dCMP are also good substrates. IMP is phosphorylated to a much lesser extent. All nucleoside triphosphates ATP, GTP, UTP, CTP, dATP, dCTP, dGTP, and TTP are accepted as phosphate donors. CTP is the best phosphate donor, followed by UTP, ATP, GTP and dCTP. May have a role in nuclear energy homeostasis. Has also ATPase activity. May be involved in regulation of Cajal body (CB) formation..
• Protein Sequence: MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8 (in isoform 2)	Phosphorylation	-	3.53	-
16	Ubiquitination	TGTPGVGKTTLGKEL ECCCCCCCCHHHHHH	35.61	-
21	Ubiquitination	VGKTTLGKELASKSG CCCCHHHHHHHHHCC	53.30	33845483
23	Ubiquitination	KTTLGKELASKSGLK CCHHHHHHHHHCCCC	8.11	33845483
26	Ubiquitination	LGKELASKSGLKYIN HHHHHHHHCCCCEEE	42.82	33845483
27	Ubiquitination	GKELASKSGLKYINV HHHHHHHCCCCEEEH	47.03	22053931
30	Ubiquitination	LASKSGLKYINVGDL HHHHCCCCEEEHHHH	47.84	21890473
31	Phosphorylation	ASKSGLKYINVGDLA HHHCCCCEEEHHHHH	11.63	27642862
44	Phosphorylation	LAREEQLYDGYDEEY HHHHHHCCCCCCCCC	13.66	11764873
51	Phosphorylation	YDGYDEEYDCPILDE CCCCCCCCCCCCCCC	22.31	28796482
97	Phosphorylation	HIVFVLRTDTNVLYE EEEEEEECCCCHHHH	42.91	20068231
99	Phosphorylation	VFVLRTDTNVLYERL EEEEECCCCHHHHHH	26.98	20068231
103	Phosphorylation	RTDTNVLYERLETRG ECCCCHHHHHHHHCC	8.50	28796482
112	Ubiquitination	RLETRGYNEKKLTDN HHHHCCCCCCCCCCC	58.39	29967540
115	Ubiquitination	TRGYNEKKLTDNIQC HCCCCCCCCCCCCCC	50.90	29967540
134	Ubiquitination	VLYEEATASYKEEIV HHHHHHHHHHHHHHH	20.22	29967540
137	Ubiquitination	EEATASYKEEIVHQL HHHHHHHHHHHHHHC	46.50	29967540
145	Ubiquitination	EEIVHQLPSNKPEEL HHHHHHCCCCCHHHH	29.32	29967540
148	Ubiquitination	VHQLPSNKPEELENN HHHCCCCCHHHHCHH	59.13	29967540
165	Ubiquitination	QILKWIEQWIKDHNS HHHHHHHHHHHHCCC	37.75	21890473
165	Ubiquitination	QILKWIEQWIKDHNS HHHHHHHHHHHHCCC	37.75	21890473
168	Ubiquitination	KWIEQWIKDHNS--- HHHHHHHHHCCC---	50.40	21890473
168	Ubiquitination	KWIEQWIKDHNS--- HHHHHHHHHCCC---	50.40	21890473
172	Phosphorylation	QWIKDHNS------- HHHHHCCC-------	37.87	21712546

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KAD6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KAD6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KAD6_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of KAD6_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.