KCTD6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KCTD6_HUMAN
• UniProt AC: Q8NC69
• Protein Name: BTB/POZ domain-containing protein KCTD6
• Gene Name: KCTD6
• Organism: Homo sapiens (Human).
• Sequence Length: 237
• Subcellular Localization: Cytoplasm, myofibril, sarcomere, M line . Colocalizes with ANK1 isoform Mu17 at the M line in differentiated skeletal muscle cells and heart.
• Protein Description: Probable substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex mediating the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the ubiquitination of HDAC1; the function seems to depend on KCTD11:KCTD6 oligomerization. Can function as antagonist of the Hedgehog pathway by affecting the nuclear transfer of transcription factor GLI1; the function probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. Inhibits cell growth and tumorigenicity of medulloblastoma (MDB). [PubMed: 21472142 Involved in regulating protein levels of ANK1 isoform Mu17 probably implicating CUL3-dependent proteasomal degradation]
• Protein Sequence: MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
125	Phosphorylation	EEVVELSSTRKLSKY HHHHHHHHCCCHHHC	44.87	30631047
199	Phosphorylation	VHLMEYITKQGFTIR HHHHHHHHHCCCEEE	19.20	18491316
204	Phosphorylation	YITKQGFTIRNTRVH HHHHCCCEEECCCEE	26.33	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KCTD6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KCTD6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KCTD6_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
OBSCN_HUMAN	OBSCN	physical	22573887
KCTD6_HUMAN	KCTD6	physical	25416956
CUL3_HUMAN	CUL3	physical	25974686
UBP21_HUMAN	USP21	physical	27621083
CUL3_HUMAN	CUL3	physical	27621083

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.