UniProt ID | SDHB_HUMAN | |
---|---|---|
UniProt AC | P21912 | |
Protein Name | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial | |
Gene Name | SDHB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 280 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side. |
|
Protein Description | Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).. | |
Protein Sequence | MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MAAVVALSLRRRLPA CHHHHHHHHHHCCCC | 24719451 | ||
41 | Acetylation | ATAPRIKKFAIYRWD HHCCCCCEEEEEECC | 25825284 | ||
51 | Acetylation | IYRWDPDKAGDKPHM EEECCCCCCCCCCCC | - | ||
55 | Acetylation | DPDKAGDKPHMQTYE CCCCCCCCCCCEEEE | - | ||
55 | Malonylation | DPDKAGDKPHMQTYE CCCCCCCCCCCEEEE | 32601280 | ||
55 | Ubiquitination | DPDKAGDKPHMQTYE CCCCCCCCCCCEEEE | 29967540 | ||
67 | Acetylation | TYEVDLNKCGPMVLD EEEECHHHHHHHHHH | 25038526 | ||
78 | Ubiquitination | MVLDALIKIKNEVDS HHHHHHHHHHHCCCC | 23503661 | ||
80 | 2-Hydroxyisobutyrylation | LDALIKIKNEVDSTL HHHHHHHHHCCCCCE | - | ||
80 | Ubiquitination | LDALIKIKNEVDSTL HHHHHHHHHCCCCCE | 23503661 | ||
119 | Phosphorylation | ACTRRIDTNLNKVSK EEEEECCCCHHHCCE | 20068231 | ||
123 | Ubiquitination | RIDTNLNKVSKIYPL ECCCCHHHCCEEECC | 21906983 | ||
126 | Succinylation | TNLNKVSKIYPLPHM CCHHHCCEEECCCCE | 23954790 | ||
126 | Acetylation | TNLNKVSKIYPLPHM CCHHHCCEEECCCCE | 25038526 | ||
126 | Ubiquitination | TNLNKVSKIYPLPHM CCHHHCCEEECCCCE | 22817900 | ||
144 | Phosphorylation | KDLVPDLSNFYAQYK HHHCCCHHHHHHHHH | 28152594 | ||
147 | Phosphorylation | VPDLSNFYAQYKSIE CCCHHHHHHHHHCCH | 28152594 | ||
150 | Phosphorylation | LSNFYAQYKSIEPYL HHHHHHHHHCCHHHH | 28152594 | ||
151 | Ubiquitination | SNFYAQYKSIEPYLK HHHHHHHHCCHHHHC | 23503661 | ||
158 | Succinylation | KSIEPYLKKKDESQE HCCHHHHCCCCCCHH | 23954790 | ||
159 | Ubiquitination | SIEPYLKKKDESQEG CCHHHHCCCCCCHHH | 29967540 | ||
160 | Ubiquitination | IEPYLKKKDESQEGK CHHHHCCCCCCHHHH | 29967540 | ||
167 | Ubiquitination | KDESQEGKQQYLQSI CCCCHHHHHHHHHHH | 23503661 | ||
167 | Acetylation | KDESQEGKQQYLQSI CCCCHHHHHHHHHHH | 25038526 | ||
170 | Phosphorylation | SQEGKQQYLQSIEER CHHHHHHHHHHHHHH | 29396449 | ||
206 | Phosphorylation | YWWNGDKYLGPAVLM CCCCCCCCCHHHHHH | 28634298 | ||
216 | Phosphorylation | PAVLMQAYRWMIDSR HHHHHHHHHHHHHCC | - | ||
222 | Phosphorylation | AYRWMIDSRDDFTEE HHHHHHHCCCCCCHH | 27251275 | ||
233 | Ubiquitination | FTEERLAKLQDPFSL CCHHHHHHCCCCCCH | 22817900 | ||
233 | Acetylation | FTEERLAKLQDPFSL CCHHHHHHCCCCCCH | 25953088 | ||
233 | Ubiquitination | FTEERLAKLQDPFSL CCHHHHHHCCCCCCH | 21890473 | ||
241 | Phosphorylation | LQDPFSLYRCHTIMN CCCCCCHHHCCCHHH | 29496907 | ||
261 | Ubiquitination | PKGLNPGKAIAEIKK CCCCCCHHHHHHHHH | 27667366 | ||
267 | Ubiquitination | GKAIAEIKKMMATYK HHHHHHHHHHHHHHH | - | ||
272 | Phosphorylation | EIKKMMATYKEKKAS HHHHHHHHHHHHHHC | 29759185 | ||
273 | Phosphorylation | IKKMMATYKEKKASV HHHHHHHHHHHHHCC | 29759185 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDHB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDHB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDHB_HUMAN !! |
loading...