UniProt ID | RT10_HUMAN | |
---|---|---|
UniProt AC | P82664 | |
Protein Name | 28S ribosomal protein S10, mitochondrial | |
Gene Name | MRPS10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 201 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEEKEESKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Phosphorylation | GNFSVNTSKGNTAKN CCEEEECCCCCCCCC | 33.10 | - | |
30 | Phosphorylation | VNTSKGNTAKNGGLL EECCCCCCCCCCCEE | 47.91 | - | |
60 | Ubiquitination | DVPKDLTKPVVTISD CCCCCCCCCEEEECC | 43.01 | - | |
74 | 2-Hydroxyisobutyrylation | DEPDILYKRLSVLVK CCCCHHHHHHHHHHC | 43.34 | - | |
93 | Phosphorylation | AVLDSYEYFAVLAAK HHHHHHHHHHHHHHH | 6.65 | - | |
105 | Phosphorylation | AAKELGISIKVHEPP HHHHHCCEEEEECCC | 17.98 | 24719451 | |
119 | Phosphorylation | PRKIERFTLLQSVHI CCCCCEEEEEEEEEH | 32.55 | 24719451 | |
123 | Phosphorylation | ERFTLLQSVHIYKKH CEEEEEEEEEHHHHH | 18.68 | 20068231 | |
127 | Phosphorylation | LLQSVHIYKKHRVQY EEEEEEHHHHHHHHH | 10.10 | 20068231 | |
140 | Phosphorylation | QYEMRTLYRCLELEH HHHHHHHHHHHHHHH | 9.92 | - | |
156 | Phosphorylation | TGSTADVYLEYIQRN HCCCHHHHHHHHHHH | 8.38 | 22817900 | |
159 | Phosphorylation | TADVYLEYIQRNLPE CHHHHHHHHHHHCCC | 10.35 | 22817900 | |
185 | Ubiquitination | EQLPEHIKEPIWETL HHCCHHCCCCHHHHH | 60.38 | - | |
191 | Phosphorylation | IKEPIWETLSEEKEE CCCCHHHHHHHHHHH | 22.16 | 25159151 | |
193 | Phosphorylation | EPIWETLSEEKEESK CCHHHHHHHHHHHHC | 51.64 | 21815630 | |
196 | Ubiquitination | WETLSEEKEESKS-- HHHHHHHHHHHCC-- | 63.83 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT10_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RT14_HUMAN | MRPS14 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...