UniProt ID | RT14_HUMAN | |
---|---|---|
UniProt AC | O60783 | |
Protein Name | 28S ribosomal protein S14, mitochondrial | |
Gene Name | MRPS14 {ECO:0000312|HGNC:HGNC:14049} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 128 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MAAFMLGSLLRTFKQ CHHHHHHHHHHHHHH | 21.92 | 28978645 | |
19 | Phosphorylation | TFKQMVPSSASGQVR HHHHHCCCCCCCCCH | 27.42 | 26657352 | |
20 | Phosphorylation | FKQMVPSSASGQVRS HHHHCCCCCCCCCHH | 22.00 | 26657352 | |
42 | Ubiquitination | WRDVKRRKMAYEYAD HHHHHHHHHHHHHHC | 31.73 | 24816145 | |
61 | Phosphorylation | INSLRKNTILPKILQ HHHHCCCCCHHHHHH | 27.25 | 25599653 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT14_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...