RT14_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RT14_HUMAN
• UniProt AC: O60783
• Protein Name: 28S ribosomal protein S14, mitochondrial
• Gene Name: MRPS14 {ECO:0000312|HGNC:HGNC:14049}
• Organism: Homo sapiens (Human).
• Sequence Length: 128
• Subcellular Localization: Mitochondrion .
• Protein Sequence: MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MAAFMLGSLLRTFKQ CHHHHHHHHHHHHHH	21.92	28978645
19	Phosphorylation	TFKQMVPSSASGQVR HHHHHCCCCCCCCCH	27.42	26657352
20	Phosphorylation	FKQMVPSSASGQVRS HHHHCCCCCCCCCHH	22.00	26657352
42	Ubiquitination	WRDVKRRKMAYEYAD HHHHHHHHHHHHHHC	31.73	24816145
61	Phosphorylation	INSLRKNTILPKILQ HHHHCCCCCHHHHHH	27.25	25599653

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RT14_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RT14_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RT14_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RS2_HUMAN	RPS2	physical	26344197

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.