NDUA6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDUA6_HUMAN
• UniProt AC: P56556
• Protein Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 {ECO:0000305}
• Gene Name: NDUFA6 {ECO:0000312|HGNC:HGNC:7690}
• Organism: Homo sapiens (Human).
• Sequence Length: 128
• Subcellular Localization: Mitochondrion inner membrane ; Peripheral membrane protein ; Matrix side .
• Protein Description: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone..
• Protein Sequence: MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	SGVRQATSTASTFVK CCCCCCCCCCHHHHH	24.78	23186163
30	Phosphorylation	RDMNEAKRRVRELYR CCHHHHHHHHHHHHH	25.28	25599653
36	Phosphorylation	KRRVRELYRAWYREV HHHHHHHHHHHHHHC	20.48	25599653
37	Phosphorylation	RRVRELYRAWYREVP HHHHHHHHHHHHHCC	25.62	14702039
38	Phosphorylation	RVRELYRAWYREVPN HHHHHHHHHHHHCCC	21.92	25599653
40	Phosphorylation	RELYRAWYREVPNTV HHHHHHHHHHCCCCE	23.59	25599653
41	Phosphorylation	ELYRAWYREVPNTVH HHHHHHHHHCCCCEE	29.95	25599653
44	Ubiquitination	RAWYREVPNTVHQFQ HHHHHHCCCCEEEEE	28.36	21890473
48	Phosphorylation	REVPNTVHQFQLDIT HHCCCCEEEEECEEE	28.26	21406692
72	Phosphorylation	EMFMKNAHVTDPRVV HHHHHCCCCCCHHHE	17.19	20068231
81	Phosphorylation	TDPRVVDLLVIKGKI CCHHHEEEEEEECEE	17.46	20068231
103	Methylation	VWKQRTHVMRFFHET HHHHCCHHHHHHCCC	43.85	115484693
111	Ubiquitination	MRFFHETEAPRPKDF HHHHCCCCCCCCHHH	46.82	21890473
111	Acetylation	MRFFHETEAPRPKDF HHHHCCCCCCCCHHH	46.82	25953088
119	Phosphorylation	APRPKDFLSKFYVGH CCCCHHHHHHHCCCC	19.40	27251275
121	Ubiquitination	RPKDFLSKFYVGHDP CCHHHHHHHCCCCCC	49.84	21890473
142	Ubiquitination	--------------------- ---------------------	63.49	21890473
147	Ubiquitination	-------------------------- --------------------------	42.75	21890473
149	Phosphorylation	---------------------------- ----------------------------	14.84	29496907

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDUA6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDUA6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDUA6_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BAG6_HUMAN	BAG6	physical	16169070
TBPL1_HUMAN	TBPL1	physical	16169070

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.