UniProt ID | C560_HUMAN | |
---|---|---|
UniProt AC | Q99643 | |
Protein Name | Succinate dehydrogenase cytochrome b560 subunit, mitochondrial | |
Gene Name | SDHC | |
Organism | Homo sapiens (Human). | |
Sequence Length | 169 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).. | |
Protein Sequence | MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 (in isoform 5) | Phosphorylation | - | 23.55 | 23663014 | |
35 | Ubiquitination | VPLGTTAKEEMERFW CCCCCCCHHHHHHHH | 52.71 | 21906983 | |
35 (in isoform 2) | Ubiquitination | - | 52.71 | - | |
44 (in isoform 2) | Ubiquitination | - | 40.30 | - | |
60 | Phosphorylation | SPHITIYSWSLPMAM CCCEEEEEECHHHHH | 13.31 | - | |
141 | Ubiquitination | HLMWDLGKGLKIPQL HHHHHCCCCCCHHHH | 69.26 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of C560_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of C560_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of C560_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
XRCC6_HUMAN | XRCC6 | physical | 21900206 | |
GDIR1_HUMAN | ARHGDIA | physical | 21900206 |
loading...