UniProt ID | NDUB6_HUMAN | |
---|---|---|
UniProt AC | O95139 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 | |
Gene Name | NDUFB6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 128 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTGYTPDEK ------CCCCCCCHH | 38.61 | 20068231 | |
2 | Acetylation | ------MTGYTPDEK ------CCCCCCCHH | 38.61 | 20068231 | |
4 | Phosphorylation | ----MTGYTPDEKLR ----CCCCCCCHHHH | 13.11 | 20068231 | |
5 | Phosphorylation | ---MTGYTPDEKLRL ---CCCCCCCHHHHH | 26.13 | 21815630 | |
9 | Ubiquitination | TGYTPDEKLRLQQLR CCCCCCHHHHHHHHH | 46.41 | - | |
24 | Acetylation | ELRRRWLKDQELSPR HHHHHHHHCCCCCCC | 50.86 | - | |
24 | Ubiquitination | ELRRRWLKDQELSPR HHHHHHHHCCCCCCC | 50.86 | 21890473 | |
24 | Ubiquitination | ELRRRWLKDQELSPR HHHHHHHHCCCCCCC | 50.86 | 21890473 | |
24 | Malonylation | ELRRRWLKDQELSPR HHHHHHHHCCCCCCC | 50.86 | 26320211 | |
29 | Phosphorylation | WLKDQELSPREPVLP HHHCCCCCCCCCCCC | 22.59 | 21815630 | |
49 | Acetylation | PMEKFWNKFLENKSP HHHHHHHHHHHCCCH | 41.75 | 25825284 | |
49 | Ubiquitination | PMEKFWNKFLENKSP HHHHHHHHHHHCCCH | 41.75 | 21890473 | |
49 | Ubiquitination | PMEKFWNKFLENKSP HHHHHHHHHHHCCCH | 41.75 | 21890473 | |
49 | Malonylation | PMEKFWNKFLENKSP HHHHHHHHHHHCCCH | 41.75 | 26320211 | |
54 | Malonylation | WNKFLENKSPWRKMV HHHHHHCCCHHHHHH | 48.82 | 26320211 | |
54 | 2-Hydroxyisobutyrylation | WNKFLENKSPWRKMV HHHHHHCCCHHHHHH | 48.82 | - | |
54 | Ubiquitination | WNKFLENKSPWRKMV HHHHHHCCCHHHHHH | 48.82 | 21890473 | |
54 | Ubiquitination | WNKFLENKSPWRKMV HHHHHHCCCHHHHHH | 48.82 | 21890473 | |
55 | Phosphorylation | NKFLENKSPWRKMVH HHHHHCCCHHHHHHH | 41.08 | - | |
66 | Ubiquitination | KMVHGVYKKSIFVFT HHHHHHHHHHHHHHH | 37.32 | - | |
66 | 2-Hydroxyisobutyrylation | KMVHGVYKKSIFVFT HHHHHHHHHHHHHHH | 37.32 | - | |
66 | Succinylation | KMVHGVYKKSIFVFT HHHHHHHHHHHHHHH | 37.32 | 23954790 | |
66 | Acetylation | KMVHGVYKKSIFVFT HHHHHHHHHHHHHHH | 37.32 | 7668107 | |
67 | Acetylation | MVHGVYKKSIFVFTH HHHHHHHHHHHHHHH | 30.97 | 30585695 | |
88 (in isoform 2) | Phosphorylation | - | 7.30 | - | |
91 | Phosphorylation | YYMKYHVSEKPYGIV HHHHHCCCCCCCCEE | 26.96 | 28442448 | |
93 | Ubiquitination | MKYHVSEKPYGIVEK HHHCCCCCCCCEEEC | 35.71 | 21890473 | |
93 | Acetylation | MKYHVSEKPYGIVEK HHHCCCCCCCCEEEC | 35.71 | 27452117 | |
94 (in isoform 2) | Phosphorylation | - | 28.65 | - | |
95 | Phosphorylation | YHVSEKPYGIVEKKS HCCCCCCCCEEECCC | 30.47 | 28152594 | |
100 | Ubiquitination | KPYGIVEKKSRIFPG CCCCEEECCCCCCCC | 45.19 | - | |
100 | 2-Hydroxyisobutyrylation | KPYGIVEKKSRIFPG CCCCEEECCCCCCCC | 45.19 | - | |
109 | Phosphorylation | SRIFPGDTILETGEV CCCCCCCEEECCCCC | 33.12 | 20068231 | |
113 | Phosphorylation | PGDTILETGEVIPPM CCCEEECCCCCCCCH | 34.89 | 20068231 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
NDUV1_HUMAN | NDUFV1 | physical | 22939629 | |
RT28_HUMAN | MRPS28 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...