UniProt ID | RM20_HUMAN | |
---|---|---|
UniProt AC | Q9BYC9 | |
Protein Name | 39S ribosomal protein L20, mitochondrial | |
Gene Name | MRPL20 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 149 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Ubiquitination | FRIQEVLKHARHFRG HHHHHHHHHHHHHCC | 40.15 | 33845483 | |
26 | Acetylation | FRIQEVLKHARHFRG HHHHHHHHHHHHHCC | 40.15 | - | |
26 | Ubiquitination | FRIQEVLKHARHFRG HHHHHHHHHHHHHCC | 40.15 | - | |
26 | Acetylation | FRIQEVLKHARHFRG HHHHHHHHHHHHHCC | 40.15 | 26822725 | |
39 | Phosphorylation | RGRKNRCYRLAVRTV CCCCCHHHHHHHHHH | 12.86 | 24719451 | |
45 | Phosphorylation | CYRLAVRTVIRAFVK HHHHHHHHHHHHHHH | 17.43 | 24719451 | |
55 | Ubiquitination | RAFVKCTKARYLKKK HHHHHHHHHHHHHHC | 40.09 | 24816145 | |
62 | Ubiquitination | KARYLKKKNMRTLWI HHHHHHHCCCCEEEH | 55.15 | 24816145 | |
82 | Ubiquitination | ASQEHGLKYPALIGN HHHHCCCCCCHHHCH | 54.50 | 23000965 | |
82 | Ubiquitination | ASQEHGLKYPALIGN HHHHCCCCCCHHHCH | 54.50 | 21890473 | |
100 | Ubiquitination | CQVELNRKVLADLAI HHHHCCHHHHHHHHC | 40.29 | 23000965 | |
108 | Phosphorylation | VLADLAIYEPKTFKS HHHHHHCCCCCCHHH | 22.14 | - | |
111 | Ubiquitination | DLAIYEPKTFKSLAA HHHCCCCCCHHHHHH | 55.44 | 21906983 | |
114 | Ubiquitination | IYEPKTFKSLAALAS CCCCCCHHHHHHHHH | 50.20 | 27667366 | |
121 | Phosphorylation | KSLAALASRRRHEGF HHHHHHHHHHCCCCH | 27.46 | 24719451 | |
136 | 2-Hydroxyisobutyrylation | AAALGDGKEPEGIFS HHHHCCCCCCCCHHH | 74.88 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM20_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM20_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM20_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...