UniProt ID | RENR_HUMAN | |
---|---|---|
UniProt AC | O75787 | |
Protein Name | Renin receptor | |
Gene Name | ATP6AP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 350 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).. | |
Protein Sequence | MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | GVLGNEFSILKSPGS HHHCCCCHHCCCCCE | 22.34 | 24719451 | |
24 | Phosphorylation | NEFSILKSPGSVVFR CCCHHCCCCCEEEEE | 30.92 | 25159151 | |
27 | Phosphorylation | SILKSPGSVVFRNGN HHCCCCCEEEEECCC | 20.63 | 23186163 | |
49 | Phosphorylation | IPDVAALSMGFSVKE CCCCHHHHCCCCCCC | 16.48 | 22210691 | |
53 | Phosphorylation | AALSMGFSVKEDLSW HHHHCCCCCCCCCCC | 26.92 | 22210691 | |
81 | Ubiquitination | ATVMVMVKGVNKLAL CEEEEEECCCCCCCC | 38.76 | 29967540 | |
107 | Ubiquitination | NAVPFSLDSVANSIH CCCCCCHHHHHHHHH | 39.61 | 21890473 | |
139 | Ubiquitination | ERVYMVGKANSVFED CEEEEEECHHHHHHH | 32.74 | 21906983 | |
150 | Phosphorylation | VFEDLSVTLRQLRNR HHHHHHHHHHHHHHH | 16.91 | 24719451 | |
192 | Ubiquitination | SELQVLHDISSLLSR HHHHHHHHHHHHHHH | 38.00 | 21890473 | |
195 | Phosphorylation | QVLHDISSLLSRHKH HHHHHHHHHHHHCHH | 33.39 | 24719451 | |
198 | Phosphorylation | HDISSLLSRHKHLAK HHHHHHHHHCHHHHC | 37.32 | 24719451 | |
201 | Ubiquitination | SSLLSRHKHLAKDHS HHHHHHCHHHHCCCC | 38.92 | 23503661 | |
205 | Ubiquitination | SRHKHLAKDHSPDLY HHCHHHHCCCCCCCH | 63.43 | 23503661 | |
206 | Ubiquitination | RHKHLAKDHSPDLYS HCHHHHCCCCCCCHH | 41.72 | 21890473 | |
224 | Ubiquitination | AGLDEIGKRYGEDSE CCHHHHHHHHCCCHH | 48.37 | 21906983 | |
238 | Ubiquitination | EQFRDASKILVDALQ HHHHHHHHHHHHHHH | 41.60 | 23000965 | |
252 | Ubiquitination | QKFADDMYSLYGGNA HHHHHHHHHHHCCCE | 11.52 | 21890473 | |
272 | Phosphorylation | TVKSFDTSLIRKTRT EEEECCHHHHHHHHH | 24.52 | 24719451 | |
275 | Methylation | SFDTSLIRKTRTILE ECCHHHHHHHHHHHH | 39.32 | - | |
284 | Ubiquitination | TRTILEAKQAKNPAS HHHHHHHHHCCCCCC | 41.22 | 22817900 | |
287 | Methylation | ILEAKQAKNPASPYN HHHHHHCCCCCCCCC | 62.05 | - | |
287 | Ubiquitination | ILEAKQAKNPASPYN HHHHHHCCCCCCCCC | 62.05 | 22817900 | |
287 | Trimethylation | ILEAKQAKNPASPYN HHHHHHCCCCCCCCC | 62.05 | - | |
291 | Phosphorylation | KQAKNPASPYNLAYK HHCCCCCCCCCEEHH | 29.22 | 25159151 | |
293 | Phosphorylation | AKNPASPYNLAYKYN CCCCCCCCCEEHHCC | 21.95 | 21406692 | |
297 | Phosphorylation | ASPYNLAYKYNFEYS CCCCCEEHHCCCCHH | 19.71 | 21406692 | |
314 | Ubiquitination | FNMVLWIMIALALAV HHHHHHHHHHHHHHH | 0.71 | 21890473 | |
346 | Ubiquitination | IYRMTNQKIRMD--- HHHHCCCCCCCC--- | 34.06 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RENR_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RENR_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RENR_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00577 | Syndromic X-linked mental retardation with epilepsy or seizures, including: West syndrome (WS); Part | |||||
OMIM Disease | ||||||
300423 | Mental retardation, X-linked, with epilepsy (MRXE) | |||||
300911 | Parkinsonism with spasticity, X-linked (XPDS) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...