UniProt ID | RENI_HUMAN | |
---|---|---|
UniProt AC | P00797 | |
Protein Name | Renin | |
Gene Name | REN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 406 | |
Subcellular Localization | Secreted. Membrane. Associated to membranes via binding to ATP6AP2. | |
Protein Description | Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.. | |
Protein Sequence | MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | IFLKRMPSIRESLKE HHHHHCHHHHHHHHH | 25.57 | 28674151 | |
45 | Phosphorylation | RMPSIRESLKERGVD HCHHHHHHHHHCCCC | 34.59 | - | |
71 | N-linked_Glycosylation | MKRLTLGNTTSSVIL CCEEECCCCCCEEEE | 43.21 | UniProtKB CARBOHYD | |
71 | N-linked_Glycosylation | MKRLTLGNTTSSVIL CCEEECCCCCCEEEE | 43.21 | 3066525 | |
87 | Phosphorylation | NYMDTQYYGEIGIGT CCCCCCEEEECCCCC | 9.85 | - | |
141 | N-linked_Glycosylation | DSSSYKHNGTELTLR CCCCCCCCCEEEEEE | 55.73 | UniProtKB CARBOHYD | |
141 | N-linked_Glycosylation | DSSSYKHNGTELTLR CCCCCCCCCEEEEEE | 55.73 | 3066525 | |
330 | Phosphorylation | VKCNEGPTLPDISFH EECCCCCCCCCEEEE | 62.88 | - | |
347 | Phosphorylation | GKEYTLTSADYVFQE CEEEEECCCCEEEEC | 23.43 | - | |
355 | Phosphorylation | ADYVFQESYSSKKLC CCEEEECCCCCCCCE | 21.38 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RENI_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RENI_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RENI_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RENR_HUMAN | ATP6AP2 | physical | 12045255 | |
ANGT_HUMAN | AGT | physical | 12045255 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00541 | Uromodulin-associated kidney diseases, including: Medullary cystic kidney disease 2; Familial juveni | |||||
H00575 | Renal tubular dysgenesis | |||||
OMIM Disease | ||||||
267430 | Renal tubular dysgenesis (RTD) | |||||
613092 | Familial juvenile hyperuricemic nephropathy 2 (HNFJ2) | |||||
Kegg Drug | ||||||
D03208 | Aliskiren (USAN/INN); Rasilez (TN) | |||||
D03738 | Enalkiren (USAN/INN) | |||||
D03741 | Ditekiren (USAN) | |||||
D03743 | Terlakiren (USAN/INN) | |||||
D03745 | Zankiren hydrochloride (USAN) | |||||
D06412 | Aliskiren fumarate (JAN/USAN); Aliskiren hemifumarate; Tekturna (TN) | |||||
D09038 | Remikiren (INN) | |||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...