VMA21_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VMA21_HUMAN
• UniProt AC: Q3ZAQ7
• Protein Name: Vacuolar ATPase assembly integral membrane protein VMA21 {ECO:0000255|HAMAP-Rule:MF_03058}
• Gene Name: VMA21 {ECO:0000255|HAMAP-Rule:MF_03058}
• Organism: Homo sapiens (Human).
• Sequence Length: 101
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Endoplasmic reticulum-Golgi intermediate compartment membrane ; Multi-pass membrane protein . Cytoplasmic vesicle, COPII-coated vesicle membrane ; Multi-pass membrane protein .
• Protein Description: Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum..
• Protein Sequence: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	PPEFRNESSLASTLK CHHHCCHHHHHHHHH	33.91	28857561
22	Phosphorylation	PEFRNESSLASTLKT HHHCCHHHHHHHHHH	23.06	28857561
25	Phosphorylation	RNESSLASTLKTLLF CCHHHHHHHHHHHHH	39.30	28857561

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VMA21_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VMA21_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VMA21_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of VMA21_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.