UniProt ID | RABL3_HUMAN | |
---|---|---|
UniProt AC | Q5HYI8 | |
Protein Name | Rab-like protein 3 | |
Gene Name | RABL3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 236 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTRTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MASLDRVKVL -----CCCCCCEEEE | 29.51 | 21406692 | |
8 | 2-Hydroxyisobutyrylation | MASLDRVKVLVLGDS CCCCCCEEEEEECCC | 30.64 | - | |
8 | Ubiquitination | MASLDRVKVLVLGDS CCCCCCEEEEEECCC | 30.64 | 29967540 | |
15 | Phosphorylation | KVLVLGDSGVGKSSL EEEEECCCCCCHHHH | 33.31 | 20068231 | |
20 | Phosphorylation | GDSGVGKSSLVHLLC CCCCCCHHHHHHHHH | 23.99 | 21406692 | |
21 | Phosphorylation | DSGVGKSSLVHLLCQ CCCCCHHHHHHHHHC | 37.59 | 21406692 | |
36 | Phosphorylation | NQVLGNPSWTVGCSV CCCCCCCCEEECEEE | 39.10 | 21406692 | |
38 | Phosphorylation | VLGNPSWTVGCSVDV CCCCCCEEECEEEEE | 16.03 | 21406692 | |
42 | Phosphorylation | PSWTVGCSVDVRVHD CCEEECEEEEEEEEE | 18.54 | 21406692 | |
51 | Ubiquitination | DVRVHDYKEGTPEEK EEEEEECCCCCCCCC | 56.58 | - | |
58 | Acetylation | KEGTPEEKTYYIELW CCCCCCCCEEEEEEE | 39.92 | 30591753 | |
85 | Phosphorylation | KSTRAVFYNSVNGII CCCEEEEEECCCEEE | 10.42 | - | |
110 | Phosphorylation | SQNLRRWSLEALNRD CHHHHHHCHHHHCCC | 17.96 | 28450419 | |
130 | Phosphorylation | VLVTNGDYDQEQFAD EEEECCCCCHHHHCC | 22.41 | 23532336 | |
156 | 2-Hydroxyisobutyrylation | LDQIHETKRHEVLTR HHHHHHHHHHHHHHH | 49.09 | - | |
156 | Ubiquitination | LDQIHETKRHEVLTR HHHHHHHHHHHHHHH | 49.09 | 29967540 | |
180 | Glutathionylation | PEEINLDCTNPRYLA HHHCCCCCCCHHHCC | 4.45 | 22555962 | |
185 | Phosphorylation | LDCTNPRYLAAGSSN CCCCCHHHCCCCCCC | 11.27 | 29496907 | |
191 | Phosphorylation | RYLAAGSSNAVKLSR HHCCCCCCCCHHHHH | 28.08 | 22461510 | |
195 | Ubiquitination | AGSSNAVKLSRFFDK CCCCCCHHHHHHHHH | 38.03 | 29967540 | |
202 | Ubiquitination | KLSRFFDKVIEKRYF HHHHHHHHHHHHHHH | 39.70 | 24816145 | |
206 | Ubiquitination | FFDKVIEKRYFLREG HHHHHHHHHHHHCCC | 41.07 | - | |
207 | Ubiquitination | FDKVIEKRYFLREGN HHHHHHHHHHHCCCC | 18.04 | 21890473 | |
221 | Ubiquitination | NQIPGFPDRKRFGAG CCCCCCCCCCCCCCC | 67.48 | 21890473 | |
222 | Methylation | QIPGFPDRKRFGAGT CCCCCCCCCCCCCCC | 32.08 | 115490007 | |
229 | Phosphorylation | RKRFGAGTLKSLHYD CCCCCCCCCCCCCCC | 30.40 | 28857561 | |
231 | Methylation | RFGAGTLKSLHYD-- CCCCCCCCCCCCC-- | 51.30 | 42366077 | |
231 | Ubiquitination | RFGAGTLKSLHYD-- CCCCCCCCCCCCC-- | 51.30 | 21906983 | |
232 | Phosphorylation | FGAGTLKSLHYD--- CCCCCCCCCCCC--- | 24.40 | 29214152 | |
235 | Phosphorylation | GTLKSLHYD------ CCCCCCCCC------ | 28.74 | - | |
245 | Ubiquitination | ---------------- ---------------- | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RABL3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RABL3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RABL3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
SIR5_HUMAN | SIRT5 | physical | 28514442 | |
RELL1_HUMAN | RELL1 | physical | 28514442 | |
RHOA_HUMAN | RHOA | physical | 28514442 | |
GDS1_HUMAN | RAP1GDS1 | physical | 28514442 | |
STOM_HUMAN | STOM | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...