| UniProt ID | CREB3_HUMAN | |
|---|---|---|
| UniProt AC | O43889 | |
| Protein Name | Cyclic AMP-responsive element-binding protein 3 | |
| Gene Name | CREB3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 371 | |
| Subcellular Localization |
Isoform 1: Endoplasmic reticulum membrane Single-pass type II membrane protein . Golgi apparatus . Colocalizes with HCFC1 in neuronal cell bodies of the trigeminal ganglia (PubMed:10623756). Colocalizes with DCSTAMP in the ER membrane of immature d |
|
| Protein Description | Endoplasmic reticulum (ER)-bound sequence-specific transcription factor that directly binds DNA and activates transcription. [PubMed: 9271389] | |
| Protein Sequence | MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Phosphorylation | LPLSEVPSDWEVDDL CCHHHCCCCCCHHHH | 61.61 | 26074081 | |
| 89 (in isoform 2) | Phosphorylation | - | 17.63 | - | |
| 89 (in isoform 3) | Phosphorylation | - | 17.63 | - | |
| 94 (in isoform 3) | Phosphorylation | - | 35.95 | - | |
| 94 (in isoform 2) | Phosphorylation | - | 35.95 | - | |
| 127 | Ubiquitination | LVLTDEEKSLLEKEG HHCCHHHHHHHHHCC | 44.61 | 23503661 | |
| 132 (in isoform 2) | Ubiquitination | - | 27.16 | 21906983 | |
| 132 | Ubiquitination | EEKSLLEKEGLILPE HHHHHHHHCCCCCCC | 27.16 | 23503661 | |
| 152 | Phosphorylation | KTEEQILKRVRRKIR CCHHHHHHHHHHHHH | 41.27 | 24719451 | |
| 152 | Ubiquitination | KTEEQILKRVRRKIR CCHHHHHHHHHHHHH | 41.27 | 29967540 | |
| 156 | Ubiquitination | QILKRVRRKIRNKRS HHHHHHHHHHHCCHH | 57.99 | 21906983 | |
| 157 | Ubiquitination | ILKRVRRKIRNKRSA HHHHHHHHHHCCHHH | 50.27 | 29967540 | |
| 170 | Ubiquitination | SAQESRRKKKVYVGG HHHHHHHHCCEECCH | 39.25 | 29967540 | |
| 184 | Ubiquitination | GLESRVLKYTAQNME HHHHHHHHHHHHHHH | 47.79 | 23503661 | |
| 184 (in isoform 2) | Ubiquitination | - | 47.79 | 21906983 | |
| 187 | Phosphorylation | SRVLKYTAQNMELQN HHHHHHHHHHHHHHH | 35.59 | 24702127 | |
| 191 | Phosphorylation | KYTAQNMELQNKVQL HHHHHHHHHHHHHHH | 25.88 | 24702127 | |
| 194 | Acetylation | AQNMELQNKVQLLEE HHHHHHHHHHHHHHH | 56.70 | - | |
| 195 | Ubiquitination | QNMELQNKVQLLEEQ HHHHHHHHHHHHHHC | 45.73 | 29967540 | |
| 204 | Phosphorylation | QLLEEQNLSLLDQLR HHHHHCCCHHHHHHH | 32.50 | 28270605 | |
| 208 | Ubiquitination | EQNLSLLDQLRKLQA HCCCHHHHHHHHHHC | 37.38 | 2190698 | |
| 263 (in isoform 2) | Phosphorylation | - | 1.72 | 27251275 | |
| 287 | Phosphorylation | PALQSEVPKDSTHQW CCCCCCCCCCCCCCC | 18.64 | 24719451 | |
| 295 | Phosphorylation | KDSTHQWLDGSDCVL CCCCCCCCCCCCEEE | 56.32 | 30622161 | |
| 299 | Phosphorylation | HQWLDGSDCVLQAPG CCCCCCCCEEEECCC | 37.74 | 30622161 | |
| 307 | N-linked_Glycosylation | CVLQAPGNTSCLLHY EEEECCCCCEEEEEE | 39.38 | - | |
| 308 | Phosphorylation | VLQAPGNTSCLLHYM EEECCCCCEEEEEEC | 41.22 | 30622161 | |
| 331 | N-linked_Glycosylation | PLEWPFPDLFSEPLC CCCCCCCCCCCCCCC | 27.97 | UniProtKB CARBOHYD | |
| 348 | N-linked_Glycosylation | PILPLQANLTRKGGW CCCCCCCCCCCCCCC | 34.12 | - | |
| 372 | N-linked_Glycosylation | LQDRYSG-------- EECCCCC-------- | 29.05 | UniProtKB CARBOHYD | |
| 376 | Ubiquitination | YSG------------ CCC------------ | 57.45 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 46 | S | Phosphorylation | Kinase | CK2A1 | P68400 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CREB3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CREB3_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
