UniProt ID | ICAM4_HUMAN | |
---|---|---|
UniProt AC | Q14773 | |
Protein Name | Intercellular adhesion molecule 4 | |
Gene Name | ICAM4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 271 | |
Subcellular Localization |
Isoform Long: Cell membrane Single-pass type I membrane protein. Isoform Short: Secreted . Cell membrane Single-pass type I membrane protein . |
|
Protein Description | ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.. | |
Protein Sequence | MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MGSLFPLSLL -----CCCCHHHHHH | 26.07 | 24043423 | |
8 | Phosphorylation | MGSLFPLSLLFFLAA CCCCHHHHHHHHHHH | 24.22 | 24043423 | |
17 | Phosphorylation | LFFLAAAYPGVGSAL HHHHHHHCCCHHHHH | 8.87 | 24043423 | |
22 | Phosphorylation | AAYPGVGSALGRRTK HHCCCHHHHHHHHCC | 20.22 | 24043423 | |
28 | Phosphorylation | GSALGRRTKRAQSPK HHHHHHHCCCCCCCC | 24.42 | 26657352 | |
33 | Phosphorylation | RRTKRAQSPKGSPLA HHCCCCCCCCCCCCC | 27.82 | 24825855 | |
37 | O-linked_Glycosylation | RAQSPKGSPLAPSGT CCCCCCCCCCCCCCC | 23.90 | OGP | |
42 | O-linked_Glycosylation | KGSPLAPSGTSVPFW CCCCCCCCCCCCCEE | 49.44 | OGP | |
68 | N-linked_Glycosylation | PGKSVQLNCSNSCPQ CCCCEEEECCCCCCC | 15.30 | UniProtKB CARBOHYD | |
78 | N-linked_Glycosylation | NSCPQPQNSSLRTPL CCCCCCCCCCCCCCC | 40.00 | UniProtKB CARBOHYD | |
150 | Phosphorylation | VLKGRKYTLRCHVTQ CCCCCEEEEEEEEEE | 15.68 | 24719451 | |
190 | N-linked_Glycosylation | FTGLDLANVTLTYEF HCCCCCEEEEEEEEE | 34.30 | UniProtKB CARBOHYD | |
223 | N-linked_Glycosylation | LDGLVVRNSSAPITL CCEEEEECCCCCEEE | 28.80 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ICAM4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ICAM4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ICAM4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
K1H1_HUMAN | KRT31 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...