UniProt ID | PDGFC_HUMAN | |
---|---|---|
UniProt AC | Q9NRA1 | |
Protein Name | Platelet-derived growth factor C | |
Gene Name | PDGFC | |
Organism | Homo sapiens (Human). | |
Sequence Length | 345 | |
Subcellular Localization | Cytoplasm, cytosol . Secreted . Nucleus . Cytoplasmic granule . Cell membrane . Sumoylated form is predominant in the nucleus (PubMed:15247255). Stored in alpha granules in platelets (PubMed:15061151). | |
Protein Description | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton formation during embryonic development, especially for normal development of the craniofacial skeleton and for normal development of the palate. Required for normal skin morphogenesis during embryonic development. Plays an important role in wound healing, where it appears to be involved in three stages: inflammation, proliferation and remodeling. Plays an important role in angiogenesis and blood vessel development. Involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain has mitogenic activity in coronary artery smooth muscle cells, suggesting a role beyond the maintenance of the latency of the PDGF domain. In the nucleus, PDGFC seems to have additional function.. | |
Protein Sequence | MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSLFGLLLL ------CCHHHHHHH | 32.19 | 26503514 | |
10 | Phosphorylation | LFGLLLLTSALAGQR HHHHHHHHHHHHCCC | 16.36 | 24043423 | |
11 | Phosphorylation | FGLLLLTSALAGQRQ HHHHHHHHHHHCCCC | 22.66 | 24043423 | |
25 | N-linked_Glycosylation | QGTQAESNLSSKFQF CCCCCCHHHHHCCCC | 35.13 | UniProtKB CARBOHYD | |
27 | Phosphorylation | TQAESNLSSKFQFSS CCCCHHHHHCCCCCC | 35.41 | 26503514 | |
28 | Phosphorylation | QAESNLSSKFQFSSN CCCHHHHHCCCCCCC | 40.43 | 26503514 | |
55 | N-linked_Glycosylation | RIITVSTNGSIHSPR EEEEEECCCCCCCCC | 34.41 | UniProtKB CARBOHYD | |
115 | Phosphorylation | FVEVEEPSDGTILGR EEEEECCCCCCEEEE | 52.53 | 23898821 | |
118 | Phosphorylation | VEEPSDGTILGRWCG EECCCCCCEEEEEEC | 20.30 | 23898821 | |
146 (in isoform 3) | Phosphorylation | - | 23.24 | 26270265 | |
149 (in isoform 3) | Phosphorylation | - | 26.27 | 26270265 | |
152 (in isoform 3) | Phosphorylation | - | 46.66 | 26270265 | |
155 (in isoform 3) | Phosphorylation | - | 26.46 | 26270265 | |
166 (in isoform 3) | Phosphorylation | - | 39.54 | 26270265 | |
167 (in isoform 3) | Phosphorylation | - | 5.70 | 26270265 | |
233 | Phosphorylation | AFVFGRKSRVVDLNL HHHHCCCCCEEEHHH | 29.01 | - | |
256 | Phosphorylation | SCTPRNFSVSIREEL HCCCCCCEEEHHHHH | 20.64 | 24719451 | |
258 | Phosphorylation | TPRNFSVSIREELKR CCCCCEEEHHHHHHC | 18.09 | 24719451 | |
314 | Sumoylation | EVLQLRPKTGVRGLH HHHHCCCCCCCCHHH | 52.02 | - | |
314 | Sumoylation | EVLQLRPKTGVRGLH HHHHCCCCCCCCHHH | 52.02 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDGFC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDGFC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDGFC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PDGFC_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...