FXYD3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FXYD3_HUMAN
• UniProt AC: Q14802
• Protein Name: FXYD domain-containing ion transport regulator 3
• Gene Name: FXYD3
• Organism: Homo sapiens (Human).
• Sequence Length: 87
• Subcellular Localization: Cell membrane ; Single-pass type I membrane protein .
• Protein Description: Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na(+) out of the cell and K(+) into the cell. [PubMed: 17077088 Reduces glutathionylation of the NKA beta-1 subunit ATP1B1, thus reversing glutathionylation-mediated inhibition of ATP1B1]
• Protein Sequence: MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40 (in isoform 3)	Phosphorylation	-	16.54	-
42 (in isoform 3)	Phosphorylation	-	2.09	-
68	Ubiquitination	CKCKFGQKSGHHPGE CCCCCCCCCCCCCCC	59.80	29901268
69	Phosphorylation	KCKFGQKSGHHPGET CCCCCCCCCCCCCCC	35.16	23090842
76	Phosphorylation	SGHHPGETPPLITPG CCCCCCCCCCCCCCC	35.80	28355574
77 (in isoform 4)	Phosphorylation	-	19.87	28348404
77 (in isoform 2)	Phosphorylation	-	19.87	28348404
78 (in isoform 4)	Phosphorylation	-	43.76	28348404
78 (in isoform 2)	Phosphorylation	-	43.76	28348404
81 (in isoform 4)	Phosphorylation	-	29.31	24719451
81 (in isoform 2)	Phosphorylation	-	29.31	24719451
81	Phosphorylation	GETPPLITPGSAQS- CCCCCCCCCCCCCC-	29.31	23090842
84	Phosphorylation	PPLITPGSAQS---- CCCCCCCCCCC----	25.08	23090842
87	Phosphorylation	ITPGSAQS------- CCCCCCCC-------	41.74	24275748
94	Ubiquitination	S-------------- C--------------		29901268
102 (in isoform 2)	Phosphorylation	-		24719451
125	Ubiquitination	--------------------------------------------- ---------------------------------------------		29901268
133 (in isoform 3)	Phosphorylation	-		27251275
144 (in isoform 3)	Phosphorylation	-		27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FXYD3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FXYD3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FXYD3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CR3L1_HUMAN	CREB3L1	physical	21516116

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.