UniProt ID | SWET1_HUMAN | |
---|---|---|
UniProt AC | Q9BRV3 | |
Protein Name | Sugar transporter SWEET1 | |
Gene Name | SLC50A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 221 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . Cell membrane Multi-pass membrane protein . May also localize to the endoplasmic reticulum.. |
|
Protein Description | Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1.. | |
Protein Sequence | MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | YGACVVFTLGMFSAG HHHHHHHHHHHHHCC | 15.70 | - | |
28 | Phosphorylation | GMFSAGLSDLRHMRM HHHHCCHHHHHHHCC | 33.41 | 24719451 | |
134 | Phosphorylation | QQLGLFCSVFTISMY HHHHHHHHHHHHHHH | 16.97 | - | |
154 | Phosphorylation | DLAKVIQTKSTQCLS HHHHHHCCCCCHHHC | 18.81 | - | |
216 | Phosphorylation | PQEQDRNYWLLQT-- CHHHCCCCEEEEC-- | 9.79 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWET1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWET1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWET1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SWET1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...