| UniProt ID | SCAM5_HUMAN | |
|---|---|---|
| UniProt AC | Q8TAC9 | |
| Protein Name | Secretory carrier-associated membrane protein 5 | |
| Gene Name | SCAMP5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 235 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane Multi-pass membrane protein. Recycling endosome membrane Multi-pass membrane protein. Cytoplasmic vesicle, s |
|
| Protein Description | Required for the calcium-dependent exocytosis of signal sequence-containing cytokines such as CCL5. Probably acts in cooperation with the SNARE machinery. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT) in case of endoplasmic reticulum stress by inhibiting the endocytosis pathway.. | |
| Protein Sequence | MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Phosphorylation | YYLWMLNSVTLAVNL HHHHHHHHHHHHHHH | 16.71 | 26074081 | |
| 50 | Phosphorylation | LWMLNSVTLAVNLVG HHHHHHHHHHHHHHH | 14.60 | 26074081 | |
| 170 | Phosphorylation | VFSFIALSMVHKFYR HHHHHHHHHHHHHHC | 15.10 | - | |
| 182 | Phosphorylation | FYRGSGGSFSKAQEE HHCCCCCCCCHHHHH | 29.85 | 24719451 | |
| 229 | Phosphorylation | QYSATPNYTYSNEM- CCCCCCCCCCCCCC- | 14.30 | 25884760 | |
| 230 | Phosphorylation | YSATPNYTYSNEM-- CCCCCCCCCCCCC-- | 27.41 | 25884760 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCAM5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCAM5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCAM5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SCAM5_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...