| UniProt ID | FA2H_HUMAN | |
|---|---|---|
| UniProt AC | Q7L5A8 | |
| Protein Name | Fatty acid 2-hydroxylase | |
| Gene Name | FA2H | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 372 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Microsome membrane Multi-pass membrane protein . |
|
| Protein Description | Required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids.. | |
| Protein Sequence | MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | Phosphorylation | GARLYDLSSFVRHHP CCEEECHHHHHHHCC | 20.87 | 27251275 | |
| 37 | Phosphorylation | GARLYDLSSFVRHHP CCEEECHHHHHHHCC | 20.87 | 27251275 | |
| 38 | Phosphorylation | ARLYDLSSFVRHHPG CEEECHHHHHHHCCC | 34.75 | 27251275 | |
| 70 | Phosphorylation | DGPPHRHSANARRWL CCCCCCCCHHHHHHH | 24.15 | 22210691 | |
| 115 | Ubiquitination | PAMEPRFKVVDWDKD CCCCCCEEECCCCHH | 42.50 | 29967540 | |
| 121 | Ubiquitination | FKVVDWDKDLVDWRK EEECCCCHHHCCCHH | 49.02 | 29967540 | |
| 331 | Phosphorylation | HKGSYLYSLKAHHVK CCCCEEEEEEEHHHH | 22.31 | 24719451 | |
| 338 | Ubiquitination | SLKAHHVKHHFAHQK EEEEHHHHHHHCCCC | 27.31 | 29967540 | |
| 346 | Phosphorylation | HHFAHQKSGFGISTK HHHCCCCCCCCCCHH | 32.55 | 23312004 | |
| 363 | Phosphorylation | DYCFHTLTPEKPHLK HHHHCCCCCCCCCCC | 30.47 | 24719451 | |
| 363 | Phosphorylation | DYCFHTLTPEKPHLK HHHHCCCCCCCCCCC | 30.47 | 27422710 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FA2H_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FA2H_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FA2H_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FA2H_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
