| UniProt ID | TM230_HUMAN | |
|---|---|---|
| UniProt AC | Q96A57 | |
| Protein Name | Transmembrane protein 230 | |
| Gene Name | TMEM230 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 120 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . Golgi apparatus, trans-Golgi network . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle . Early endosome . Recycling endosome . Late endosome . Cytoplasmic vesicle, autophagosome . |
|
| Protein Description | Involved in trafficking and recycling of synaptic vesicles.. | |
| Protein Sequence | MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MMPSRTNLATG ----CCCCCCCCCCC | 33.56 | 20068231 | |
| 6 | Phosphorylation | --MMPSRTNLATGIP --CCCCCCCCCCCCC | 38.63 | 20068231 | |
| 10 | Phosphorylation | PSRTNLATGIPSSKV CCCCCCCCCCCCCHH | 38.52 | 20068231 | |
| 14 | Phosphorylation | NLATGIPSSKVKYSR CCCCCCCCCHHCEEE | 40.65 | 25159151 | |
| 15 | Phosphorylation | LATGIPSSKVKYSRL CCCCCCCCHHCEEEC | 35.79 | 23401153 | |
| 16 | Ubiquitination | ATGIPSSKVKYSRLS CCCCCCCHHCEEECC | 47.27 | 21906983 | |
| 16 (in isoform 1) | Ubiquitination | - | 47.27 | 21890473 | |
| 18 | Ubiquitination | GIPSSKVKYSRLSST CCCCCHHCEEECCCC | 41.04 | - | |
| 19 | Phosphorylation | IPSSKVKYSRLSSTD CCCCHHCEEECCCCC | 11.30 | 30108239 | |
| 20 | Phosphorylation | PSSKVKYSRLSSTDD CCCHHCEEECCCCCC | 22.49 | 21712546 | |
| 23 | Phosphorylation | KVKYSRLSSTDDGYI HHCEEECCCCCCCEE | 30.04 | 22167270 | |
| 24 | Phosphorylation | VKYSRLSSTDDGYID HCEEECCCCCCCEEE | 40.21 | 22167270 | |
| 25 | Phosphorylation | KYSRLSSTDDGYIDL CEEECCCCCCCEEEE | 34.43 | 22167270 | |
| 29 | Phosphorylation | LSSTDDGYIDLQFKK CCCCCCCEEEEEECC | 9.77 | 22167270 | |
| 35 (in isoform 1) | Ubiquitination | - | 42.66 | 21890473 | |
| 35 | Ubiquitination | GYIDLQFKKTPPKIP CEEEEEECCCCCCCC | 42.66 | - | |
| 43 | Phosphorylation | KTPPKIPYKAIALAT CCCCCCCHHHHHHHH | 19.27 | - | |
| 67 (in isoform 2) | Phosphorylation | - | 4.53 | 20068231 | |
| 73 (in isoform 2) | Phosphorylation | - | 52.37 | - | |
| 77 (in isoform 2) | Phosphorylation | - | 42.20 | 24719451 | |
| 79 (in isoform 2) | Ubiquitination | - | 15.54 | 21890473 | |
| 81 (in isoform 2) | Ubiquitination | - | 17.76 | - | |
| 82 (in isoform 2) | Phosphorylation | - | 4.88 | 27642862 | |
| 83 (in isoform 2) | Phosphorylation | - | 1.61 | 24719451 | |
| 86 (in isoform 2) | Phosphorylation | - | 10.53 | 21406692 | |
| 87 (in isoform 2) | Phosphorylation | - | 1.77 | 21406692 | |
| 88 (in isoform 2) | Phosphorylation | - | 1.55 | 27642862 | |
| 92 (in isoform 2) | Phosphorylation | - | 21.27 | 27642862 | |
| 98 (in isoform 2) | Ubiquitination | - | 9.74 | 21890473 | |
| 104 | Phosphorylation | LRIAYYASKGYRGYS HHHHHHHCCCCCCCC | 15.53 | - | |
| 110 | Phosphorylation | ASKGYRGYSYDDIPD HCCCCCCCCCCCCCC | 8.61 | 26552605 | |
| 111 | Phosphorylation | SKGYRGYSYDDIPDF CCCCCCCCCCCCCCC | 25.55 | 28796482 | |
| 112 | Phosphorylation | KGYRGYSYDDIPDFD CCCCCCCCCCCCCCC | 14.78 | 28796482 | |
| 173 (in isoform 2) | Phosphorylation | - | 27642862 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM230_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM230_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM230_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TM230_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23, AND MASSSPECTROMETRY. | |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-25, AND MASSSPECTROMETRY. | |
