CQ062_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CQ062_HUMAN
• UniProt AC: Q9BQA9
• Protein Name: Uncharacterized protein C17orf62
• Gene Name: C17orf62
• Organism: Homo sapiens (Human).
• Sequence Length: 187
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAIFDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CQ062_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CQ062_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CQ062_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CQ062_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KASH5_HUMAN	CCDC155	physical	25416956
CR3L1_HUMAN	CREB3L1	physical	21516116

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.